Myotis myotis (greater mouse-eared bat): 118663066 Help Entry 118663066         CDS       T07220                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo01521   EGFR tyrosine kinase inhibitor resistance mmyo01524   Platinum drug resistance mmyo04014   Ras signaling pathway mmyo04064   NF-kappa B signaling pathway mmyo04115   p53 signaling pathway mmyo04137   Mitophagy - animal mmyo04140   Autophagy - animal mmyo04151   PI3K-Akt signaling pathway mmyo04210   Apoptosis mmyo04215   Apoptosis - multiple species mmyo04621   NOD-like receptor signaling pathway mmyo04630   JAK-STAT signaling pathway mmyo05012   Parkinson disease mmyo05014   Amyotrophic lateral sclerosis mmyo05022   Pathways of neurodegeneration - multiple diseases mmyo05145   Toxoplasmosis mmyo05162   Measles mmyo05166   Human T-cell leukemia virus 1 infection mmyo05168   Herpes simplex virus 1 infection mmyo05170   Human immunodeficiency virus 1 infection mmyo05200   Pathways in cancer mmyo05202   Transcriptional misregulation in cancer mmyo05212   Pancreatic cancer mmyo05220   Chronic myeloid leukemia mmyo05222   Small cell lung cancer mmyo05225   Hepatocellular carcinoma mmyo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmyo00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     118663066 (BCL2L1)    04630 JAK-STAT signaling pathway     118663066 (BCL2L1)    04064 NF-kappa B signaling pathway     118663066 (BCL2L1)    04151 PI3K-Akt signaling pathway     118663066 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118663066 (BCL2L1)    04137 Mitophagy - animal     118663066 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     118663066 (BCL2L1)    04215 Apoptosis - multiple species     118663066 (BCL2L1)    04115 p53 signaling pathway     118663066 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118663066 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118663066 (BCL2L1)    05202 Transcriptional misregulation in cancer     118663066 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     118663066 (BCL2L1)    05225 Hepatocellular carcinoma     118663066 (BCL2L1)    05220 Chronic myeloid leukemia     118663066 (BCL2L1)    05222 Small cell lung cancer     118663066 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118663066 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     118663066 (BCL2L1)    05162 Measles     118663066 (BCL2L1)    05168 Herpes simplex virus 1 infection     118663066 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     118663066 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     118663066 (BCL2L1)    05014 Amyotrophic lateral sclerosis     118663066 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     118663066 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118663066 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     118663066 (BCL2L1)    01524 Platinum drug resistance     118663066 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mmyo01009]     118663066 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmyo03036]     118663066 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mmyo02000]     118663066 (BCL2L1) Protein phosphatases and associated proteins [BR:mmyo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      118663066 (BCL2L1) Chromosome and associated proteins [BR:mmyo03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     118663066 (BCL2L1) Transporters [BR:mmyo02000]  Other transporters   Pores ion channels [TC:1]    118663066 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  118663066 NCBI-ProteinID:  XP_036178279 LinkDB All DBs Position Unknown AA seq 287 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLV DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWGGCWEPSEEAGATVRKCHCHDFHGLLPVPTQQPDSCWREYGNWKVMSLKAPP STNYFFWMCPSLSSCQLLSLLPPLHPSPSFSLQPLIILLRFRKCIST NT seq 864 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggaactggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagttcagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagaggtggagacccccagtgccatcaatggcaacccatcctggcacctggtg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg attcccatggcagcggtgaagcaagcgctgagggaggcaggcgatgagtttgaactgcgg taccggcgggcgttcagcgacctgacatcccagctccacatcaccccggggacagcatat cagagctttgagcaagtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctcgttcggtggggcattgtgcgtggaaagtgtggacaaggagatgcag gtattggtgagtcggattgcaacgtggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggaggctggggtggctgctgggagcccagtgaagaggctggtgca actgtcaggaaatgccattgccatgacttccatggactgcttcctgtcccaacccagcag ccagattcctgctggcgagagtatggaaactggaaagtaatgtccctaaaggctcccccc tccacaaactactttttttggatgtgtccctccctttcctcttgtcagttactttctttg cttcctccccttcacccttcacccagcttctctctccagcctctgatcattcttttaaga tttagaaaatgcatttctacttag

DBGET integrated database retrieval system