KEGG   Myotis myotis (greater mouse-eared bat): 118664256
Entry
118664256         CDS       T07220                                 
Symbol
FXYD6
Name
(RefSeq) FXYD domain-containing ion transport regulator 6 isoform X1
  KO
K13363  FXYD domain-containing ion transport regulator 6
Organism
mmyo  Myotis myotis (greater mouse-eared bat)
Brite
KEGG Orthology (KO) [BR:mmyo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmyo02000]
    118664256 (FXYD6)
Transporters [BR:mmyo02000]
 Other transporters
  Pores ion channels [TC:1]
   118664256 (FXYD6)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8 Glycophorin_A HU-CCDC81_euk_2 BRI3
Other DBs
NCBI-GeneID: 118664256
NCBI-ProteinID: XP_036180076
LinkDB
Position
Unknown
AA seq 95 aa
MEVLLILLCGLLAPTVLASASEQEKEQDPFHYDYQTLRIGGLVFAVVFFSVGILLILSRR
CKCSFSQKPRAPGDEEAQAENLITANAAEPQKAEN
NT seq 288 nt   +upstreamnt  +downstreamnt
atggaggtgctgctcatcctgctgtgcggcctgctggcccccaccgtcctggccagtgcc
agtgagcaggagaaggaacaggacccttttcattatgattaccagaccctgcggatcggg
ggattggtgtttgctgtggtcttcttctcggttggcatcctcctcatcctgagtcgcagg
tgcaagtgcagcttcagccagaagcccagggccccgggcgacgaggaggcccaggcggag
aacctcatcactgcgaacgcagcagagccccagaaagcggagaactga

DBGET integrated database retrieval system