Myotis myotis (greater mouse-eared bat): 118664770 Help Entry 118664770         CDS       T07220                                  Name (RefSeq) calmodulin-like protein 5   KO K02183   calmodulin Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04014   Ras signaling pathway mmyo04015   Rap1 signaling pathway mmyo04020   Calcium signaling pathway mmyo04022   cGMP-PKG signaling pathway mmyo04024   cAMP signaling pathway mmyo04070   Phosphatidylinositol signaling system mmyo04114   Oocyte meiosis mmyo04218   Cellular senescence mmyo04261   Adrenergic signaling in cardiomyocytes mmyo04270   Vascular smooth muscle contraction mmyo04371   Apelin signaling pathway mmyo04625   C-type lectin receptor signaling pathway mmyo04713   Circadian entrainment mmyo04720   Long-term potentiation mmyo04722   Neurotrophin signaling pathway mmyo04728   Dopaminergic synapse mmyo04740   Olfactory transduction mmyo04744   Phototransduction mmyo04750   Inflammatory mediator regulation of TRP channels mmyo04910   Insulin signaling pathway mmyo04912   GnRH signaling pathway mmyo04915   Estrogen signaling pathway mmyo04916   Melanogenesis mmyo04921   Oxytocin signaling pathway mmyo04922   Glucagon signaling pathway mmyo04924   Renin secretion mmyo04925   Aldosterone synthesis and secretion mmyo04970   Salivary secretion mmyo04971   Gastric acid secretion mmyo05010   Alzheimer disease mmyo05012   Parkinson disease mmyo05022   Pathways of neurodegeneration - multiple diseases mmyo05031   Amphetamine addiction mmyo05034   Alcoholism mmyo05133   Pertussis mmyo05152   Tuberculosis mmyo05163   Human cytomegalovirus infection mmyo05167   Kaposi sarcoma-associated herpesvirus infection mmyo05170   Human immunodeficiency virus 1 infection mmyo05200   Pathways in cancer mmyo05214   Glioma mmyo05417   Lipid and atherosclerosis mmyo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmyo00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     118664770    04015 Rap1 signaling pathway     118664770    04371 Apelin signaling pathway     118664770    04020 Calcium signaling pathway     118664770    04070 Phosphatidylinositol signaling system     118664770    04024 cAMP signaling pathway     118664770    04022 cGMP-PKG signaling pathway     118664770  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     118664770    04218 Cellular senescence     118664770  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118664770   09152 Endocrine system    04910 Insulin signaling pathway     118664770    04922 Glucagon signaling pathway     118664770    04912 GnRH signaling pathway     118664770    04915 Estrogen signaling pathway     118664770    04921 Oxytocin signaling pathway     118664770    04916 Melanogenesis     118664770    04924 Renin secretion     118664770    04925 Aldosterone synthesis and secretion     118664770   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     118664770    04270 Vascular smooth muscle contraction     118664770   09154 Digestive system    04970 Salivary secretion     118664770    04971 Gastric acid secretion     118664770   09156 Nervous system    04728 Dopaminergic synapse     118664770    04720 Long-term potentiation     118664770    04722 Neurotrophin signaling pathway     118664770   09157 Sensory system    04744 Phototransduction     118664770    04740 Olfactory transduction     118664770    04750 Inflammatory mediator regulation of TRP channels     118664770   09159 Environmental adaptation    04713 Circadian entrainment     118664770  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118664770   09162 Cancer: specific types    05214 Glioma     118664770   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118664770    05163 Human cytomegalovirus infection     118664770    05167 Kaposi sarcoma-associated herpesvirus infection     118664770   09171 Infectious disease: bacterial    05133 Pertussis     118664770    05152 Tuberculosis     118664770   09164 Neurodegenerative disease    05010 Alzheimer disease     118664770    05012 Parkinson disease     118664770    05022 Pathways of neurodegeneration - multiple diseases     118664770   09165 Substance dependence    05031 Amphetamine addiction     118664770    05034 Alcoholism     118664770   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118664770    05418 Fluid shear stress and atherosclerosis     118664770  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mmyo01009]     118664770   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmyo04131]     118664770    03036 Chromosome and associated proteins [BR:mmyo03036]     118664770   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmyo04147]     118664770 Protein phosphatases and associated proteins [BR:mmyo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      118664770 Membrane trafficking [BR:mmyo04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     118664770 Chromosome and associated proteins [BR:mmyo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      118664770 Exosome [BR:mmyo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118664770 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_9 AIF-1 EF-hand_FSTL1 Dockerin_1 Allatotropin-like_C UPF0154 SPARC_Ca_bdg CFAP251_C EF_EFCAB10_C EH Temptin_C EF-hand_STIM1 EF-hand_EFHB_C PGM_PMM_III SAPC2_N BamM_C WEF-hand MTIP_N DUF8698 DUF5580_M Motif Other DBs NCBI-GeneID:  118664770 NCBI-ProteinID:  XP_036181188 LinkDB All DBs Position Unknown AA seq 219 aa AA seqDB search SIPPGRRILPEDVGWVGSLPPPFAPTAEKEGFPPLCKTAARALPSHRHSWSQPLVHSSDG SPLNWLAASDMAEELSKEQVADFKAAFTRFDKDGDGKINVEELGAVMKALGQNPSEAELK ELIARVDTDGDGAISFQEFLAEMVKRMKSFGGEQDMKEVFRAFDLDGDGHITVDELKKAM AQIGQNLSQEDLEAMIREADVDKDGRVNYEEFSRILSQK NT seq 660 nt NT seq  +upstreamnt  +downstreamnt tctatccctcctgggaggaggattttgcctgaggatgtggggtgggtggggagcctgcct cctccctttgctccgacagcagaaaaggaggggttcccacccctttgtaagactgctgcc cgagctctgccctcacacagacacagctggtctcagccactggtccacagttctgacggg agccctttgaactggttggcagcaagcgacatggcagaggaactgtctaaagagcaggtg gctgacttcaaggcggccttcaccaggttcgacaaggacggggatggcaaaatcaacgtg gaggagctgggcgccgtcatgaaggccctgggccagaacccatcggaggccgagctgaag gagctcatcgcccgggtggacactgacggtgatggtgccatcagtttccaggagttcttg gccgagatggtgaagaggatgaagtcctttggcggtgagcaggacatgaaggaggtcttc cgagccttcgacctggacggcgatggccacatcaccgtggacgagctcaagaaggccatg gcccagatagggcagaatctctcccaggaggatctggaggccatgatccgggaggcggac gtggacaaggatggccgggtgaactatgaggagttctcacgaatactcagccagaagtga

DBGET integrated database retrieval system