Myotis myotis (greater mouse-eared bat): 118665287 Help Entry 118665287         CDS       T07220                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04360   Axon guidance mmyo04666   Fc gamma R-mediated phagocytosis mmyo04810   Regulation of actin cytoskeleton mmyo05133   Pertussis mmyo05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:mmyo00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     118665287 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     118665287 (CFL1)   09158 Development and regeneration    04360 Axon guidance     118665287 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118665287 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     118665287 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmyo04131]     118665287 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmyo04812]     118665287 (CFL1)    04147 Exosome [BR:mmyo04147]     118665287 (CFL1) Membrane trafficking [BR:mmyo04131]  Others   Actin-binding proteins    Others     118665287 (CFL1) Cytoskeleton proteins [BR:mmyo04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      118665287 (CFL1) Exosome [BR:mmyo04147]  Exosomal proteins   Proteins found in most exosomes    118665287 (CFL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF DUF4931_N Motif Other DBs NCBI-GeneID:  118665287 NCBI-ProteinID:  XP_036182504 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV SQTVDDPYATFVKMLPEKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANC NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggcctctggcgtggctgtctctgatggagtcatcaaagtgttcaatgacatgaaggta cgtaagtcctcaacaccagaggaggtgaagaagcgcaagaaggcggtgctcttctgcctg agtgaagacaagaagaacatcattctggaagagggcaaggagatcctggtaggtgatgtg agccagacagtagacgacccctacgccacttttgtcaagatgctgcccgagaaagactgc cgttatgccctgtatgatgcaacgtatgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggctcctgagtctgcgcctcttaagagcaaaatgatctatgccagctcc aaggatgccatcaagaagaagcttacggggatcaagcatgaattacaagcaaactgctag

DBGET integrated database retrieval system