Myotis myotis (greater mouse-eared bat): 118665501 Help Entry 118665501         CDS       T07220                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo03010   Ribosome mmyo04120   Ubiquitin mediated proteolysis mmyo04137   Mitophagy - animal mmyo04140   Autophagy - animal mmyo05012   Parkinson disease mmyo05022   Pathways of neurodegeneration - multiple diseases mmyo05167   Kaposi sarcoma-associated herpesvirus infection mmyo05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:mmyo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     118665501   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118665501  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118665501    04137 Mitophagy - animal     118665501  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     118665501    05167 Kaposi sarcoma-associated herpesvirus infection     118665501   09164 Neurodegenerative disease    05012 Parkinson disease     118665501    05022 Pathways of neurodegeneration - multiple diseases     118665501  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmyo03011]     118665501    04121 Ubiquitin system [BR:mmyo04121]     118665501 Ribosome [BR:mmyo03011]  Ribosomal proteins   Eukaryotes    Large subunit     118665501   Archaea     118665501 Ubiquitin system [BR:mmyo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    118665501 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  118665501 NCBI-ProteinID:  XP_036182840 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MKTGARLDVKEGAASPADTERQLFVKTLTGKIIALEVEPRDPTDNAKAKLQDREGLPPDQ QRLVSVGKQLEDGRTFRLQYSERIRPWHLALPLRRHREPSLRQFAQKYKVICAGVPPTWA PVLSTAMKCSHTNYLCF NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgaaaacaggggcaagactagatgtgaaagagggagcagcatccccagcagacacagaa cggcagctctttgtgaagaccctgactggcaagatcatcgccctggaggtggagcccagg gaccccactgacaatgccaaagctaaactccaagacagggagggcctcccgcctgaccag cagcgtctggtttctgtgggcaaacagctggaggatggacgcacattcagactacaatat tcagaaagaattcgcccttggcacttggcacttcctttgcggaggcatcgtgagccctcc ctccgccagttcgcccagaagtacaaggtgatctgtgcaggtgttccgcccacctgggcc cctgtgctatcaactgccatgaagtgcagccacaccaactatctgtgcttttag

DBGET integrated database retrieval system