Myotis myotis (greater mouse-eared bat): 118667406 Help Entry 118667406         CDS       T07220                                  Name (RefSeq) cathepsin L1-like   KO K01365   cathepsin L [EC:3.4.22.15] Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04140   Autophagy - animal mmyo04142   Lysosome biogenesis mmyo04145   Phagocytosis mmyo04210   Apoptosis mmyo04612   Antigen processing and presentation mmyo05205   Proteoglycans in cancer mmyo05323   Rheumatoid arthritis mmyo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmyo00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     118667406    04142 Lysosome biogenesis     118667406    04140 Autophagy - animal     118667406   09143 Cell growth and death    04210 Apoptosis     118667406  09150 Organismal Systems   09151 Immune system    04612 Antigen processing and presentation     118667406  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     118667406   09163 Immune disease    05323 Rheumatoid arthritis     118667406   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     118667406  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mmyo01002]     118667406   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mmyo03110]     118667406   09183 Protein families: signaling and cellular processes    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmyo00537]     118667406 Enzymes [BR:mmyo01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.15  cathepsin L      118667406 Peptidases and inhibitors [BR:mmyo01002]  Cysteine peptidases   Family C1: papain family    118667406 Chaperones and folding catalysts [BR:mmyo03110]  Intramolecular chaperones   Papain family    118667406 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmyo00537]  Others   118667406 SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C1 Peptidase_C1_2 Motif Other DBs NCBI-GeneID:  118667406 NCBI-ProteinID:  XP_036186516 LinkDB All DBs Position Unknown AA seq 183 aa AA seqDB search MFRKTGRLISLSEQNLVDCSQAQGNKGCNGGLMDNAFQYVKSNGGLDSEESYPYQAKVGP CRYRPEDSVANDTGFVDVPGQESALMKAVATVGPISVAIDASHLSFQFYEDGVYYERRCS SVHLDHGVLVVGYGFEGEESSNNTYWIVKNSWGEGWGQNGYIKMAKDRNNHCGIATAASY PTV NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atgttccggaaaactggcagacttatctcactgagtgagcagaaccttgtggactgctct caggctcaaggcaataagggctgcaatggtggcctcatggataatgctttccagtatgtg aagtccaatggcggcctggactcagaggagtcctatccatatcaagcaaaggttggaccc tgcagatacaggcccgaggactctgttgccaatgacaccggcttcgtggacgtccctggg caggagagtgccctcatgaaggcagtggcaaccgtggggcccatctcggtggctatagat gcaagccatcttagcttccagttctatgaagatggcgtttattatgagcggcgctgcagc agcgtgcatctagatcatggcgttctggtggttggctatggctttgaaggagaagaatca agtaacaatacatattggattgtcaagaacagctggggtgaaggttggggccagaatggc tacataaagatggccaaggaccggaacaaccactgtggaatcgccaccgcggccagctat cctactgtgtga

DBGET integrated database retrieval system