Myotis myotis (greater mouse-eared bat): 118668681 Help Entry 118668681         CDS       T07220                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo03010   Ribosome mmyo04120   Ubiquitin mediated proteolysis mmyo04137   Mitophagy - animal mmyo04140   Autophagy - animal mmyo05012   Parkinson disease mmyo05022   Pathways of neurodegeneration - multiple diseases mmyo05167   Kaposi sarcoma-associated herpesvirus infection mmyo05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:mmyo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     118668681   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118668681  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118668681    04137 Mitophagy - animal     118668681  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     118668681    05167 Kaposi sarcoma-associated herpesvirus infection     118668681   09164 Neurodegenerative disease    05012 Parkinson disease     118668681    05022 Pathways of neurodegeneration - multiple diseases     118668681  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmyo03011]     118668681    04121 Ubiquitin system [BR:mmyo04121]     118668681   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmyo04147]     118668681 Ribosome [BR:mmyo03011]  Ribosomal proteins   Eukaryotes    Small subunit     118668681   Archaea     118668681 Ubiquitin system [BR:mmyo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    118668681 Exosome [BR:mmyo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118668681   Exosomal proteins of colorectal cancer cells    118668681 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 OTU1_UBXL TBK1_ULD Motif Other DBs NCBI-GeneID:  118668681 NCBI-ProteinID:  XP_036189753 LinkDB All DBs Position Unknown AA seq 146 aa AA seqDB search MQIFMKTLTGKTITLEVEPSDTIENIRAKIQDKKGIPPDQQRLIFAGNNVYKNGRTLSDY NILKESTLHLVLRLCGGAKKRKKQSYTTPKKNKPKRKKVKLAVLKYHKVDENGTTNRLRR ECPSDECGAGVFMAATLTDIIVANVV NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgcagattttcatgaaaaccctcacggggaagaccatcactctcgaggttgaaccctcg gatacgatagaaaacataagggccaagatccaggataagaaaggaattcctcctgatcag caaagactgatctttgctggcaataatgtttacaagaatgggcgtactttgtctgactac aacattctaaaggagtccactcttcatcttgtgttgagactttgtggtggtgctaagaag aggaagaagcagtcttacaccacccccaagaagaacaagcctaagagaaagaaggtgaag ctggctgtcctgaaataccacaaagtggatgagaatggcacaaccaatcgccttcgccgg gagtgcccttcagatgaatgtggtgctggggtttttatggcagccaccttgacagacatt attgtggcaaatgttgtctga

DBGET integrated database retrieval system