Myotis myotis (greater mouse-eared bat): 118671766 Help Entry 118671766         CDS       T07220                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04081   Hormone signaling mmyo04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:mmyo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     118671766 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     118671766 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmyo04052]     118671766 (GAST) Cytokines and neuropeptides [BR:mmyo04052]  Neuropeptides   GPCR binding    118671766 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  118671766 NCBI-ProteinID:  XP_036196438 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCVQALILALALAAFSEASWKPRSQLQDAPSGPEAKRALEARWLDQLGPAAHHQRQL RFPDPPHPVADLSKKQGPWLEEEEEAYGWMDFGRRSAEEGDQQP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcggctctgcgtgcaagcgctgatcctggctctggctctggccgccttctcagaa gcctcctggaagccccgctcgcagctgcaggacgcaccctcgggcccagaggccaagagg gccctggaggcacgttggctggaccagctgggcccagccgctcaccaccaaaggcagctg aggttcccggatcccccacacccggtggcagacctgtccaagaagcaggggccgtggctg gaggaagaggaagaagcgtatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaacagccctag

DBGET integrated database retrieval system