Myotis myotis (greater mouse-eared bat): 118672334 Help Entry 118672334         CDS       T07220                                  Name (RefSeq) C-C motif chemokine 2-like   KO K14624   C-C motif chemokine 2 Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04060   Cytokine-cytokine receptor interaction mmyo04061   Viral protein interaction with cytokine and cytokine receptor mmyo04062   Chemokine signaling pathway mmyo04621   NOD-like receptor signaling pathway mmyo04657   IL-17 signaling pathway mmyo04668   TNF signaling pathway mmyo04933   AGE-RAGE signaling pathway in diabetic complications mmyo05135   Yersinia infection mmyo05142   Chagas disease mmyo05144   Malaria mmyo05163   Human cytomegalovirus infection mmyo05164   Influenza A mmyo05168   Herpes simplex virus 1 infection mmyo05171   Coronavirus disease mmyo05323   Rheumatoid arthritis mmyo05417   Lipid and atherosclerosis mmyo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmyo00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     118672334   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118672334    04061 Viral protein interaction with cytokine and cytokine receptor     118672334  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118672334    04657 IL-17 signaling pathway     118672334    04062 Chemokine signaling pathway     118672334  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease     118672334    05164 Influenza A     118672334    05168 Herpes simplex virus 1 infection     118672334    05163 Human cytomegalovirus infection     118672334   09171 Infectious disease: bacterial    05135 Yersinia infection     118672334   09174 Infectious disease: parasitic    05144 Malaria     118672334    05142 Chagas disease     118672334   09163 Immune disease    05323 Rheumatoid arthritis     118672334   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118672334    05418 Fluid shear stress and atherosclerosis     118672334   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     118672334  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmyo04052]     118672334    00536 Glycosaminoglycan binding proteins [BR:mmyo00536]     118672334 Cytokines and neuropeptides [BR:mmyo04052]  Cytokines   Chemokines    118672334 Glycosaminoglycan binding proteins [BR:mmyo00536]  Heparan sulfate / Heparin   Chemokines    118672334 SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  118672334 NCBI-ProteinID:  XP_036197850 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKVSAALLCLLLTVAALTTQVLSQPDAVTSPITCCYTFTEKTIPMPKLASYKKVTSSKCP KEAVIFKTKLGKDVCADPQLKWVQNAVKLLDKKTQTPKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagcgctcctgtgcctgctgctcaccgtggccgccctcaccacccag gtgctctctcagccagacgcagtcacttccccaatcacctgctgctatacattcaccgag aagacgatcccgatgccaaagctggcgagctacaaaaaagtcaccagcagcaagtgcccc aaagaagctgtgatcttcaagaccaaactgggcaaggatgtctgtgctgacccccagctg aagtgggttcagaatgctgtgaagcttctagacaagaaaacccaaactccaaagccttga

DBGET integrated database retrieval system