Myotis myotis (greater mouse-eared bat): 118673407 Help Entry 118673407         CDS       T07220                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo03082   ATP-dependent chromatin remodeling mmyo04217   Necroptosis mmyo04613   Neutrophil extracellular trap formation mmyo05034   Alcoholism mmyo05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmyo00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     118673407  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     118673407  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118673407  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     118673407   09165 Substance dependence    05034 Alcoholism     118673407  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmyo03036]     118673407   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmyo04147]     118673407 Chromosome and associated proteins [BR:mmyo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118673407 Exosome [BR:mmyo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118673407 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  118673407 NCBI-ProteinID:  XP_036200038 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcgggaaacaaggaggcaaagctcgcgctaaggccaagtcccgctcttcc cgcgccggtctccagttcccggtggggcgtgtgcaccgtctcctgcgcaagggcaactac gccgagcgggtgggagccggcgcgccggtgtacatggcggcggtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgagacaacaagaagacgcgcatcatc ccccgtcacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaag gtcaccatcgcccagggcggcgtcttgcccaacatccaggctgttctgttaccaaagaaa accgaaagccacaaggctaaaagcaaatga

DBGET integrated database retrieval system