Myotis myotis (greater mouse-eared bat): 118675889 Help Entry 118675889         CDS       T07220                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mmyo  Myotis myotis (greater mouse-eared bat) Brite KEGG Orthology (KO) [BR:mmyo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mmyo03041]     118675889   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmyo04052]     118675889 Spliceosome [BR:mmyo03041]  Complex B   Other components    Complex B specific factors     118675889 Cytokines and neuropeptides [BR:mmyo04052]  Neuropeptides   Neuropeptides (Unclassified)    118675889 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Ubiquitin_4 Crinkler HLH Motif Other DBs NCBI-GeneID:  118675889 NCBI-ProteinID:  XP_036204685 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTNDTIGDLKKLIPAQTGTRWNKIVLKKWYTIFKDHVSLSDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtggtttgcaacgaccgtctggggaagaaggtccgagtgaagtgcaacacc aatgacaccatcggggacctgaagaagctgatccccgcccagacggggacccgttggaat aagattgtgctgaagaagtggtacacgatctttaaggaccacgtttctctgagcgactat gagatccatgatgggatgaacctggagctttattaccaataa

DBGET integrated database retrieval system