Myotis myotis (greater mouse-eared bat): 118676104 Help Entry 118676104         CDS       T07220                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo01522   Endocrine resistance mmyo04010   MAPK signaling pathway mmyo04012   ErbB signaling pathway mmyo04024   cAMP signaling pathway mmyo04137   Mitophagy - animal mmyo04210   Apoptosis mmyo04310   Wnt signaling pathway mmyo04380   Osteoclast differentiation mmyo04510   Focal adhesion mmyo04530   Tight junction mmyo04620   Toll-like receptor signaling pathway mmyo04621   NOD-like receptor signaling pathway mmyo04625   C-type lectin receptor signaling pathway mmyo04657   IL-17 signaling pathway mmyo04658   Th1 and Th2 cell differentiation mmyo04659   Th17 cell differentiation mmyo04660   T cell receptor signaling pathway mmyo04662   B cell receptor signaling pathway mmyo04668   TNF signaling pathway mmyo04722   Neurotrophin signaling pathway mmyo04912   GnRH signaling pathway mmyo04915   Estrogen signaling pathway mmyo04921   Oxytocin signaling pathway mmyo04926   Relaxin signaling pathway mmyo04932   Non-alcoholic fatty liver disease mmyo04933   AGE-RAGE signaling pathway in diabetic complications mmyo05030   Cocaine addiction mmyo05031   Amphetamine addiction mmyo05132   Salmonella infection mmyo05133   Pertussis mmyo05135   Yersinia infection mmyo05140   Leishmaniasis mmyo05142   Chagas disease mmyo05161   Hepatitis B mmyo05162   Measles mmyo05166   Human T-cell leukemia virus 1 infection mmyo05167   Kaposi sarcoma-associated herpesvirus infection mmyo05169   Epstein-Barr virus infection mmyo05170   Human immunodeficiency virus 1 infection mmyo05171   Coronavirus disease - COVID-19 mmyo05200   Pathways in cancer mmyo05203   Viral carcinogenesis mmyo05207   Chemical carcinogenesis - receptor activation mmyo05208   Chemical carcinogenesis - reactive oxygen species mmyo05210   Colorectal cancer mmyo05211   Renal cell carcinoma mmyo05224   Breast cancer mmyo05231   Choline metabolism in cancer mmyo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmyo05321   Inflammatory bowel disease mmyo05323   Rheumatoid arthritis mmyo05417   Lipid and atherosclerosis mmyo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmyo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118676104 (JUN)    04012 ErbB signaling pathway     118676104 (JUN)    04310 Wnt signaling pathway     118676104 (JUN)    04668 TNF signaling pathway     118676104 (JUN)    04024 cAMP signaling pathway     118676104 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     118676104 (JUN)   09143 Cell growth and death    04210 Apoptosis     118676104 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     118676104 (JUN)    04530 Tight junction     118676104 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118676104 (JUN)    04621 NOD-like receptor signaling pathway     118676104 (JUN)    04625 C-type lectin receptor signaling pathway     118676104 (JUN)    04660 T cell receptor signaling pathway     118676104 (JUN)    04658 Th1 and Th2 cell differentiation     118676104 (JUN)    04659 Th17 cell differentiation     118676104 (JUN)    04657 IL-17 signaling pathway     118676104 (JUN)    04662 B cell receptor signaling pathway     118676104 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     118676104 (JUN)    04915 Estrogen signaling pathway     118676104 (JUN)    04921 Oxytocin signaling pathway     118676104 (JUN)    04926 Relaxin signaling pathway     118676104 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     118676104 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     118676104 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118676104 (JUN)    05207 Chemical carcinogenesis - receptor activation     118676104 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     118676104 (JUN)    05203 Viral carcinogenesis     118676104 (JUN)    05231 Choline metabolism in cancer     118676104 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     118676104 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     118676104 (JUN)    05211 Renal cell carcinoma     118676104 (JUN)    05224 Breast cancer     118676104 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118676104 (JUN)    05170 Human immunodeficiency virus 1 infection     118676104 (JUN)    05161 Hepatitis B     118676104 (JUN)    05171 Coronavirus disease - COVID-19     118676104 (JUN)    05162 Measles     118676104 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     118676104 (JUN)    05169 Epstein-Barr virus infection     118676104 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     118676104 (JUN)    05135 Yersinia infection     118676104 (JUN)    05133 Pertussis     118676104 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     118676104 (JUN)    05142 Chagas disease     118676104 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     118676104 (JUN)    05321 Inflammatory bowel disease     118676104 (JUN)   09165 Substance dependence    05030 Cocaine addiction     118676104 (JUN)    05031 Amphetamine addiction     118676104 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118676104 (JUN)    05418 Fluid shear stress and atherosclerosis     118676104 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     118676104 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     118676104 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     118676104 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mmyo03000]     118676104 (JUN) Transcription factors [BR:mmyo03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     118676104 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf Rab11-FIP3 ZapB RIMB1_N PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  118676104 NCBI-ProteinID:  XP_036205340 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGSGGGGFSASLHSEPPVYANLSNFNPGA LSGGGGAPSYGATGLAFAAQPQQQQPPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggtgcctatggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgatccggtgggcagcctgaagccgcacctgcgggccaagaactcggacctc ctcacctcgcccgatgtggggctgcttaaactggcgtcgcccgagctggagcgcctgatc atccagtccagcaatgggcacatcaccaccacgccgacccccacccagttcctgtgcccc aagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtccgcggcgcagccggtcagcggggca ggcctggtggctccggccgtggcttcggtggcgggcggcagcggcggcggcggcttcagc gccagcctgcacagcgagccgcccgtctacgccaacctcagcaacttcaacccgggcgcg ctgagcggcggcggcggggcgccctcctacggcgcgactggcctggcgttcgccgcgcag ccccagcagcagcagccgccaccgcaaccgccgcaccacctgccccagcagatcccggtg cagcacccacggctgcaggccctgaaggaggagccgcagacggtgcccgaaatgcccggg gaaacaccgcccctctcccccatcgacatggagtcccaggagcggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagagaatt gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtctaca gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaat agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system