Myotis myotis (greater mouse-eared bat): 118677213 Help Entry 118677213         CDS       T07220                                  Name (RefSeq) polyubiquitin-like   KO K04551   ubiquitin B Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04120   Ubiquitin mediated proteolysis mmyo04137   Mitophagy - animal mmyo04140   Autophagy - animal mmyo05012   Parkinson disease mmyo05022   Pathways of neurodegeneration - multiple diseases mmyo05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:mmyo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118677213  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118677213    04137 Mitophagy - animal     118677213  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     118677213   09164 Neurodegenerative disease    05012 Parkinson disease     118677213    05022 Pathways of neurodegeneration - multiple diseases     118677213  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mmyo04121]     118677213   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmyo04147]     118677213 Ubiquitin system [BR:mmyo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    118677213 Exosome [BR:mmyo04147]  Exosomal proteins   Exosomal proteins of breast milk    118677213   Exosomal proteins of other body fluids (saliva and urine)    118677213   Exosomal proteins of colorectal cancer cells    118677213   Exosomal proteins of bladder cancer cells    118677213 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD OTU1_UBXL DUF2604 Dsc3_N Ubiquitin_5 Rad60-SLD_2 UBL_UBAC1 Motif Other DBs NCBI-GeneID:  118677213 NCBI-ProteinID:  XP_036208053 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGCILSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGCTLSDYNIQKESTLYLVLRLRGGC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcaaatcttcgtaaagaccctgactggcaagaccatcaccctagaggtggagcccagt gacaccattgagaatgttaaagccaagatccaggataaggaaggcatccctcctgaccag cagaggctcatctttgcaggcaagcagctggaagagggctgcattctttctgactacaac atccagaaagagtccaccctgcacctggtcctgcgtctgaggggtggtatgcagatcttc gtgaagaccctgaccggaaagaccatcaccctggaggtggagcccagtgataccattgag aatgtgaaggccaagatccaggataaggaaggcatccctcctgaccagcagaggctcatc tttgcaggcaagcagctggaagatggctgcactctttctgactacaacatccagaaagag tccaccctgtacctggtcctgcgtctgaggggtggctgttaa

DBGET integrated database retrieval system