Myotis myotis (greater mouse-eared bat): 118677878 Help Entry 118677878         CDS       T07220                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04024   cAMP signaling pathway mmyo04062   Chemokine signaling pathway mmyo04064   NF-kappa B signaling pathway mmyo04210   Apoptosis mmyo04380   Osteoclast differentiation mmyo04620   Toll-like receptor signaling pathway mmyo04621   NOD-like receptor signaling pathway mmyo04622   RIG-I-like receptor signaling pathway mmyo04623   Cytosolic DNA-sensing pathway mmyo04625   C-type lectin receptor signaling pathway mmyo04657   IL-17 signaling pathway mmyo04658   Th1 and Th2 cell differentiation mmyo04659   Th17 cell differentiation mmyo04660   T cell receptor signaling pathway mmyo04662   B cell receptor signaling pathway mmyo04668   TNF signaling pathway mmyo04722   Neurotrophin signaling pathway mmyo04920   Adipocytokine signaling pathway mmyo04926   Relaxin signaling pathway mmyo04931   Insulin resistance mmyo04936   Alcoholic liver disease mmyo05132   Salmonella infection mmyo05134   Legionellosis mmyo05135   Yersinia infection mmyo05140   Leishmaniasis mmyo05142   Chagas disease mmyo05145   Toxoplasmosis mmyo05160   Hepatitis C mmyo05161   Hepatitis B mmyo05162   Measles mmyo05163   Human cytomegalovirus infection mmyo05164   Influenza A mmyo05166   Human T-cell leukemia virus 1 infection mmyo05167   Kaposi sarcoma-associated herpesvirus infection mmyo05168   Herpes simplex virus 1 infection mmyo05169   Epstein-Barr virus infection mmyo05170   Human immunodeficiency virus 1 infection mmyo05171   Coronavirus disease - COVID-19 mmyo05200   Pathways in cancer mmyo05203   Viral carcinogenesis mmyo05208   Chemical carcinogenesis - reactive oxygen species mmyo05215   Prostate cancer mmyo05220   Chronic myeloid leukemia mmyo05222   Small cell lung cancer mmyo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmyo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmyo00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     118677878 (NFKBIA)    04668 TNF signaling pathway     118677878 (NFKBIA)    04024 cAMP signaling pathway     118677878 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     118677878 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118677878 (NFKBIA)    04621 NOD-like receptor signaling pathway     118677878 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     118677878 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     118677878 (NFKBIA)    04625 C-type lectin receptor signaling pathway     118677878 (NFKBIA)    04660 T cell receptor signaling pathway     118677878 (NFKBIA)    04658 Th1 and Th2 cell differentiation     118677878 (NFKBIA)    04659 Th17 cell differentiation     118677878 (NFKBIA)    04657 IL-17 signaling pathway     118677878 (NFKBIA)    04662 B cell receptor signaling pathway     118677878 (NFKBIA)    04062 Chemokine signaling pathway     118677878 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     118677878 (NFKBIA)    04926 Relaxin signaling pathway     118677878 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     118677878 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     118677878 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118677878 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     118677878 (NFKBIA)    05203 Viral carcinogenesis     118677878 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     118677878 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     118677878 (NFKBIA)    05215 Prostate cancer     118677878 (NFKBIA)    05222 Small cell lung cancer     118677878 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118677878 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     118677878 (NFKBIA)    05161 Hepatitis B     118677878 (NFKBIA)    05160 Hepatitis C     118677878 (NFKBIA)    05171 Coronavirus disease - COVID-19     118677878 (NFKBIA)    05164 Influenza A     118677878 (NFKBIA)    05162 Measles     118677878 (NFKBIA)    05168 Herpes simplex virus 1 infection     118677878 (NFKBIA)    05163 Human cytomegalovirus infection     118677878 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     118677878 (NFKBIA)    05169 Epstein-Barr virus infection     118677878 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     118677878 (NFKBIA)    05135 Yersinia infection     118677878 (NFKBIA)    05134 Legionellosis     118677878 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     118677878 (NFKBIA)    05140 Leishmaniasis     118677878 (NFKBIA)    05142 Chagas disease     118677878 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118677878 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     118677878 (NFKBIA)    04931 Insulin resistance     118677878 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mmyo03000]     118677878 (NFKBIA)    04131 Membrane trafficking [BR:mmyo04131]     118677878 (NFKBIA) Transcription factors [BR:mmyo03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     118677878 (NFKBIA) Membrane trafficking [BR:mmyo04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     118677878 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  118677878 NCBI-ProteinID:  XP_036209024 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFHPAERAQDWAMEGPRDGLKKERPLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RSSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAQALLEAGCDPELRDFRGNTPLHLACEQGSLASVGVLTQSCGTQHLQAILQATN YNGHTCLHLASIHGYLGIVERLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaccccgccgagcgcgcccaggactgggccatggagggcccccgggacgggctc aagaaggagcggccgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgcgagatccgcctggagccgcaggaagcgccg cgcagctccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcgctgacgatggaagtggtccgccaagtgaagggagac ctggcctttcttaacttccagaacaacctgcagcagactccgctccacttggctgtgatc accaaccagccagaaatcgcccaggcacttctggaagctggctgtgatcctgagctgcga gactttcgaggaaatacccccctacaccttgcctgtgagcagggcagcctggccagtgtg ggagtcctgactcagagctgtgggacccagcacctccaggccatcctgcaggccacaaac tacaatggccacacatgtctgcacttagcctccatccatggctacctgggcatcgtggag cgtttggtgtccttgggcgctgatgtcaatgcccaggagccctgtaatggccgaacggcc cttcatcttgcggtggatctgcagaatcccgacctggtgtctctcctgttgaagtgtggg gctgacgtcaacagagtcacctaccagggctactccccgtaccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgacacagagtcggagttcacagaggacgagctg ccctacgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system