Myotis myotis (greater mouse-eared bat): 118679308 Help Entry 118679308         CDS       T07220                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo00190   Oxidative phosphorylation mmyo01100   Metabolic pathways mmyo01524   Platinum drug resistance mmyo04115   p53 signaling pathway mmyo04210   Apoptosis mmyo04215   Apoptosis - multiple species mmyo04932   Non-alcoholic fatty liver disease mmyo05010   Alzheimer disease mmyo05012   Parkinson disease mmyo05014   Amyotrophic lateral sclerosis mmyo05016   Huntington disease mmyo05017   Spinocerebellar ataxia mmyo05020   Prion disease mmyo05022   Pathways of neurodegeneration - multiple diseases mmyo05132   Salmonella infection mmyo05134   Legionellosis mmyo05145   Toxoplasmosis mmyo05152   Tuberculosis mmyo05160   Hepatitis C mmyo05161   Hepatitis B mmyo05162   Measles mmyo05163   Human cytomegalovirus infection mmyo05164   Influenza A mmyo05167   Kaposi sarcoma-associated herpesvirus infection mmyo05168   Herpes simplex virus 1 infection mmyo05169   Epstein-Barr virus infection mmyo05170   Human immunodeficiency virus 1 infection mmyo05200   Pathways in cancer mmyo05210   Colorectal cancer mmyo05222   Small cell lung cancer mmyo05416   Viral myocarditis mmyo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmyo00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     118679308  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     118679308    04215 Apoptosis - multiple species     118679308    04115 p53 signaling pathway     118679308  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118679308   09162 Cancer: specific types    05210 Colorectal cancer     118679308    05222 Small cell lung cancer     118679308   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118679308    05161 Hepatitis B     118679308    05160 Hepatitis C     118679308    05164 Influenza A     118679308    05162 Measles     118679308    05168 Herpes simplex virus 1 infection     118679308    05163 Human cytomegalovirus infection     118679308    05167 Kaposi sarcoma-associated herpesvirus infection     118679308    05169 Epstein-Barr virus infection     118679308   09171 Infectious disease: bacterial    05132 Salmonella infection     118679308    05134 Legionellosis     118679308    05152 Tuberculosis     118679308   09174 Infectious disease: parasitic    05145 Toxoplasmosis     118679308   09164 Neurodegenerative disease    05010 Alzheimer disease     118679308    05012 Parkinson disease     118679308    05014 Amyotrophic lateral sclerosis     118679308    05016 Huntington disease     118679308    05017 Spinocerebellar ataxia     118679308    05020 Prion disease     118679308    05022 Pathways of neurodegeneration - multiple diseases     118679308   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118679308    05416 Viral myocarditis     118679308   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     118679308   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     118679308 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C CCP_MauG Motif Other DBs NCBI-GeneID:  118679308 NCBI-ProteinID:  XP_036211788 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MIKLNQYHPILIRILILNKNTKGVREPDIWLASDVEKGKKKCAQCHTVEKGGKHRTGPNL HGLFGQKTGQAPGFSYTDANKNKGIAWGEATLMEHLENPKKYIPGTKMLFAGLEKSAERT DLIAYLKKATHE NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgattaaactaaatcagtatcatcccatcttaataagaatactaatactcaataagaat actaaaggagttagagagccggacatctggcttgcgagtgatgttgagaagggcaagaag aagtgtgcccagtgccatactgtggagaagggaggcaagcacaggactgggccaaatctc catggtctctttgggcaaaagacaggtcaggcccctggattttcttacacagatgccaac aagaacaaaggtatcgcctggggagaggctacactgatggagcatttggagaatcccaag aagtacatccctggaacaaaaatgctcttcgctggccttgagaagagtgcagaaaggaca gacttgatagcttatctcaaaaaagctactcatgagtaa

DBGET integrated database retrieval system