Maritalea myrionectae: MXMO3_02678 Help Entry MXMO3_02678       CDS       T05588                                  Name (GenBank) exodeoxyribonuclease VII   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism mmyr  Maritalea myrionectae Pathway mmyr03430   Mismatch repair Brite KEGG Orthology (KO) [BR:mmyr00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     MXMO3_02678  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mmyr03400]     MXMO3_02678 Enzymes [BR:mmyr01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      MXMO3_02678 DNA repair and recombination proteins [BR:mmyr03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      MXMO3_02678 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S ARM_TT21_5th Nbl1_Borealin_N Motif Other DBs NCBI-ProteinID:  AVX05189 UniProt:  A0A2R4MH19 LinkDB All DBs Position 2633187..2633435 Genome browser AA seq 82 aa AA seqDB search MSEKTHSDIAEMDFETALTELEQIVGKLEAGRAPLQESIEVYERGGLLKAHCEKLLKQAE ARIEKITLDGNSQPQGTEPLDS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt gtgagcgagaaaacgcatagcgatattgccgagatggattttgaaaccgcgctgaccgag cttgagcaaattgtgggcaagcttgaagctggccgtgcgcctttgcaggaaagcattgag gtttatgagcgcggcggtttgctgaaggcccattgtgagaaattgctgaaacaggccgaa gcccggatcgaaaaaatcacgctagacggcaatagccagccgcagggcaccgagccactc gacagctag

DBGET integrated database retrieval system