KEGG   Miniopterus natalensis (Natal long-fingered bat): 107525217
Entry
107525217         CDS       T05883                                 
Symbol
RPN1
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
  KO
K12666  oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna00513  Various types of N-glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107525217 (RPN1)
   00513 Various types of N-glycan biosynthesis
    107525217 (RPN1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107525217 (RPN1)
SSDB
Motif
Pfam: Ribophorin_I FliD_C CtIP_N JAKMIP_CC3
Other DBs
NCBI-GeneID: 107525217
NCBI-ProteinID: XP_016052823
LinkDB
Position
Unknown
AA seq 621 aa
MAPARGLRLSLALVMEVPTSPLLLVLVLGAWAAAPGSASPDAPPLVNEDVKRTVDLSSHL
AKVTVELVLAHPGGSSTSRATSFLLALEPELEGRLAHLGVQVKGEDEEENNLEVRETKIK
GKSGRFFMVKLPVALDPGMKISVILETVYTHVLQPYPTQITQSEKQFVVFEGNHYFYSPY
PTKTQTMRVKLASRNVESYTKLGNPTRSEDILDYGPFRDVPAYSQDTFKVHYENNSPFLT
ITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPA
AAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLG
DQYALKMRFVDHVFDEQVIDSLTVKIILPEGARNIQVDSPYEISRAPDELHYTYLDTFGR
PVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKD
PAAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDVSTLNSGKKSLETEHKAL
TSEIALLQSRLKTEGSDLCDKVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENE
KLILGKRQELVTKIDHILDAL
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggcgccggcgcgcggcctgcggctcagcttggctcttgtcatggaggtccctacctcc
ccgctgcttctcgtccttgtgctcggggcctgggccgcagcgccgggcagcgcctctccc
gatgcaccgccgttggtcaacgaggacgtgaagcggacggtggacctgagcagccacctg
gccaaggtgacggtcgagttggtcttggcgcacccaggcggcagctccacgtcccgcgcc
acctcctttcttctggccttggagccggagctcgagggccggctggcacacctcggcgtg
caggtaaagggagaagatgaggaagagaacaatttggaagtacgagaaaccaaaattaag
ggtaaaagtgggagattcttcatggtcaagctcccagttgctctcgatcctgggatgaag
atttcagtcattttggaaacagtctatacccatgtgcttcagccatatccaacccagatc
actcaatcagagaaacagtttgtggtgtttgagggcaaccattatttctactctccctat
ccaacaaagacacaaactatgcgtgtgaagcttgcctctcgaaatgtggagagctacacc
aagttggggaaccccacacgatctgaggacattttggattacggacctttcagagatgtc
cctgcttatagtcaggatacttttaaagtacattatgagaacaacagccctttccttact
atcaccagcatgacccgagtcattgaggtctctcactggggtaatattgctgtggaagaa
aatgtggacttgaagcacacaggggcagtgcttaaggggcctttttcacgctatgattac
cagagacagccagatagtggtatatcctccattcgttcttttaagactatccttcctgct
gctgcccaggatgtttattaccgggatgagattggcaatgtttccaccagccacctcctt
attttggatgactccgtagagatggaaatccggcctcgtttccctctttttggagggtgg
aagacccattacattgttggctacaacctcccaagctatgagtacctctataatttgggt
gaccagtatgcactgaagatgaggtttgtggaccatgtttttgatgagcaagtgatagat
tctctgactgtgaagatcatcttgcctgaaggagccaggaacatccaagttgacagtccc
tatgaaatcagccgtgccccagatgagctgcactacacctacctggacacatttggccgc
cctgtgattgttgcctacaaaaaaaatctggtagaacagcacattcaggacatcgtggta
cactacacattcaacaaggtgctcatgctgcaggagcccctgctggtagtggccgctttc
tacatcttgttcttcacagtcatcatctacgtcaggctggacttttctatcacaaaggat
ccagccgcagaagccaggatgaaggtggcctgcatcacagagcaggtcttgaccctggtt
aataagagaataggtctctaccgtcactttgatgagactgtcaataggtataagcagtcc
cgggatgtgtccaccctcaacagtggcaagaagagcctggagacagagcacaaggccttg
accagtgagattgcactgctgcagtccaggctgaagacagagggctctgacttgtgtgac
aaagtgagcgaaatgcagaaactggatgcacaggtcaaggagctggtgctgaagtcggca
gtggaagctgagcggctggttgctggcaagctcaagaaagacacgtacatcgagaatgaa
aagctcatcttaggaaagcgacaggagctggtcactaagatcgaccacatcctggatgct
ctgtag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107526382
Entry
107526382         CDS       T05883                                 
Symbol
STT3B
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna00513  Various types of N-glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107526382 (STT3B)
   00513 Various types of N-glycan biosynthesis
    107526382 (STT3B)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107526382 (STT3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107526382 (STT3B)
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     107526382 (STT3B)
Glycosyltransferases [BR:mna01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   107526382 (STT3B)
SSDB
Motif
Pfam: STT3
Other DBs
NCBI-GeneID: 107526382
NCBI-ProteinID: XP_016054308
LinkDB
Position
Unknown
AA seq 730 aa
MMKMNFYLQFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWI
LNTLNITVHIRDVCVFLAPTFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSV
AGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTVCCCLSYFYMVSAWGGYVFIINLIPLH
VFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAF
LQYLRDRLTKQEFQTLFFLGVSVAAGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIH
IPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGV
MVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDEDDKRNPGNLYDKAGK
VRKHVTEQEKTEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDG
TRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGK
AMSSNETAAYKIMRSLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYF
TPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHL
EEAFTSEHWLVRIYKVKGPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFK
KGKKISKKTV
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgatgaagatgaacttctaccttcagtttaactatagatcaacacatcatcttgcatct
catgggttctatgaatttttaaattggtttgatgaaagagcatggtatccactaggaaga
atagtaggtggtactgtttacccagggttaatgataacagctggccttatccattggata
ttaaatacattgaacataacagttcacataagagatgtatgtgtgttccttgcaccaact
tttagcggccttacatctatatctactttcctgcttaccagagaactttggaaccaagga
gcaggacttttagctgcttgttttattgctattgtaccaggctacatttctcgatcagta
gctggatcctttgataacgaaggcattgctatttttgcacttcagttcacatactactta
tgggtaaaatctgtaaaaactgggtctgttttttggacagtgtgctgctgcttatcgtat
ttctatatggtctctgcttggggtggttatgtgtttattatcaaccttattccactgcat
gtatttgtgttattactgatgcagagatacagcaaaagagtctacatagcatatagcact
ttctacattgtgggtttaatattatccatgcagataccctttgtgggattccagccaatc
agaacaagtgagcacatggcagctgcaggtgtctttgcattgctgcaagcttatgctttc
ttgcagtatctgagagaccgattaacaaaacaagagttccagacccttttctttttgggt
gtatcagtagctgcaggtgctgtgttccttagtgtcatctatttgacttacacaggttac
attgcaccatggagtggcaggttttactcattgtgggacactgggtatgcaaaaatacat
attccaattattgcatcagtatctgagcatcaacctacgacttgggtgtctttcttcttt
gatctacatattcttgtgtgtaccttcccagcaggcctatggttctgcattaaaaatatc
aacgatgaaagagtatttgttgctctgtatgcaatcagcgctgtctactttgctggagtg
atggtgcggctgatgttgactttgactccggtcgtctgtatgctgtctgcaattgccttc
tcaaatgtttttgagcactatttgggggatgacatgaaaagggaaaacccacctgtggag
gacagcagtgatgaggatgacaaaagaaacccaggaaatttgtatgataaggcaggtaaa
gtcaggaaacatgtaactgaacaggaaaaaactgaagagggattgggtcctaatataaaa
agcattgtcaccatgttgatgctgatgctattgatgatgtttgcagtccactgtacgtgg
gtcacaagcaatgcctactctagtccaagtgtggtcctggcctcttacaatcatgatggc
accaggaatatcttagatgattttagagaagcttacttttggctaaggcaaaatacagat
gaacatgcccgagtgatgtcttggtgggattatggctatcagatagctggaatggctaat
agaactactttggtggacaataatacctggaataacagccacatagcactggtgggaaaa
gctatgtcttcaaatgaaacagcagcctataaaatcatgaggagtctggacgtagattat
gttttggttatttttggaggggttattggctattctggtgatgacatcaacaagtttctc
tggatggttaggatagctgaaggggaacatccaaaagacattcgggaaagtgactatttc
accccacaaggagaattccgtgtagacaaagcaggatcccccactttattgaattgcctt
atgtataaaatgtcatattacagatttggggaaatgcagttggattttcgtacacccccg
ggttttgatcgaacacgtaatgctgagattggaaacaaggacattaaattcaagcatttg
gaggaggcctttacatcagaacactggcttgtaagaatatataaagtgaaaggacctgat
aacagggaaacactagaccacaaacctcgagtcaccaacattttcccaaaacagaagtat
ctgtcaaagaagactacgaaaaggaagcgtggctacattaaaaataagctcgtttttaag
aaaggcaagaaaatatctaagaagactgtttaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107530589
Entry
107530589         CDS       T05883                                 
Symbol
STT3A
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna00513  Various types of N-glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107530589 (STT3A)
   00513 Various types of N-glycan biosynthesis
    107530589 (STT3A)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107530589 (STT3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107530589 (STT3A)
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     107530589 (STT3A)
Glycosyltransferases [BR:mna01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   107530589 (STT3A)
SSDB
Motif
Pfam: STT3 PMT_2 DUF6131 DUF6798 DUF2985
Other DBs
NCBI-GeneID: 107530589
NCBI-ProteinID: XP_016059896
LinkDB
Position
Unknown
AA seq 705 aa
MTKLGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFL
AEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLA
PLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTY
YMWIKAVKTGSIYWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAY
CTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFR
SVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSY
YFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGI
GVSQVLSTYMKNLDISRPDKKSRKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTS
EAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTI
LVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMV
RIGGSTDTGRHIKEHDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGF
DRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRGLSRT
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgactaagttgggatttttgcggctgtcctatgagaagcaggacacacttctgaagctt
ctcattctgtcaatggctgctgtgttatcattctccactcgtctctttgctgtcctgaga
tttgaaagtgtcatccatgagtttgatccgtactttaattatcggactaccaggttcctt
gctgaggagggattttataaattccataactggtttgatgaccgggcctggtacccactg
ggccgaatcattggaggaacaatttacccaggcttaatgatcacctctgctgcaatctac
catgtactccattttttccacatcaccatcgacattcggaatgtctgtgtgttcctggcc
cctctcttctcttccttcaccaccatcgtcacgtaccaccttaccaaagagctcaaggat
gcaggggctggacttcttgctgctgccatgattgctgtagttcctggatatatctcccga
tctgtggctggctcctatgataatgaaggaattgccatcttttgcatgctactcacctac
tacatgtggatcaaagcagtcaagactggttccatctactgggcagccaaatgtgccctt
gcttatttctacatggtctcttcatggggaggttatgtattcttgatcaacttgatccct
ctccatgtactggtgctgatgctcacaggacgtttctcccaccggatctatgtggcctac
tgtactgtttactgcctgggcaccattctttcaatgcagatctcctttgtgggttttcag
cccgtcctttcatcagagcacatggcagcctttggggtttttggtctctgccagatccat
gcctttgtggattatctgcgcagcaagttgaacccacagcagtttgaagttcttttccga
agtgtcatctctctggtgggctttgttcttctcaccgtcggagctctcctcatgctgaca
ggaaaaatatctccctggacggggcgtttctactcactgctggatccttcttatgctaag
aacaacatccccatcattgcttctgtgtctgagcatcagcctacgacctggtcttcatac
tattttgatctacagcttcttgtcttcatgtttccagtcggtctctattactgctttagc
aacctgtctgatgcccggattttcatcatcatgtatggtgtgaccagcatgtacttttcg
gctgtaatggttcgtctgatgctagtgttggcacctgttatgtgcattctttctggcatt
ggagtctcccaagtgctgtccacttatatgaagaatctggacataagtcgtccagacaag
aagagcaggaagcagcaggattctacctaccctattaagaatgaagtggcaagtgggatg
atattggtcatggctttctttctcatcacctacacctttcattcgacctgggtgaccagc
gaggcctactcttctccctccatcgtgctgtctgctcgtggtggggatggcagtaggatc
atttttgatgactttcgagaagcctactattggcttcgtcacaatactccagaggatgcg
aaggtcatgtcatggtgggattatggctaccagattacagctatggcgaatcggacgatt
ttagtggacaataacacatggaataatacccatatttctcgagtagggcaggcaatggca
tccacagaagaaaaagcctatgagatcatgagagagcttgatgttagctatgtgctggtc
atttttggaggtcttactggatattcctctgatgacatcaacaagtttctgtggatggtc
cggattggagggagtacagatactggcagacatatcaaggagcatgattattatactcca
actggggaattccgtgtggaccgggagggttctccagtgctgctcaactgccttatgtat
aagatgtgttactaccgctttggacaggtctacacagaagccaagcgtcctccaggcttc
gaccgtgtgcggaatgctgagatagggaataaagactttgagcttgatgtcctggaggaa
gcatataccacagagcattggctagtcaggatatacaaggtaaaggacctggataatcga
ggcttgtcaaggacataa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107531686
Entry
107531686         CDS       T05883                                 
Symbol
DAD1
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 isoform X1
  KO
K12668  oligosaccharyltransferase complex subunit epsilon
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna00513  Various types of N-glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107531686 (DAD1)
   00513 Various types of N-glycan biosynthesis
    107531686 (DAD1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107531686 (DAD1)
SSDB
Motif
Pfam: DAD
Other DBs
NCBI-GeneID: 107531686
NCBI-ProteinID: XP_016061276
LinkDB
Position
Unknown
AA seq 113 aa
MSASVVSVISRFLEEYLSTTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
NT seq 342 nt   +upstreamnt  +downstreamnt
atgtctgcctcagtggtgtcggtgatttctcggttcttagaagagtacttgagcaccact
cctcagcgtctgaagttgctggacgcgtacctcctgtacatattgctgaccggggcgctg
cagttcggttattgtctcctcgtggggaccttccccttcaactcgttcctctcgggcttc
atctcctgtgtggggagcttcatcctagcggtttgtctgagaatacagatcaacccacag
aacaaagcggatttccaaggcatctccccagagcgtgcctttgctgattttctctttgcc
agcaccatcctgcaccttgttgtcatgaacttcgttggctga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107534078
Entry
107534078         CDS       T05883                                 
Symbol
TUSC3
Name
(RefSeq) tumor suppressor candidate 3 isoform X1
  KO
K12669  oligosaccharyltransferase complex subunit gamma
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna00513  Various types of N-glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107534078 (TUSC3)
   00513 Various types of N-glycan biosynthesis
    107534078 (TUSC3)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107534078 (TUSC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107534078 (TUSC3)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC58: MagT-like magnesium transporter
   107534078 (TUSC3)
SSDB
Motif
Pfam: OST3_OST6 Thioredoxin DUF4131 Gram_pos_anchor
Other DBs
NCBI-GeneID: 107534078
NCBI-ProteinID: XP_016064525
LinkDB
Position
Unknown
AA seq 291 aa
MEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSW
RYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTYDLQRIGFAAE
QLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSL
CIVFAMTSGQMWNHIRGPPYAYKNPHNGQVSYIHGNSQGQFVAESHIILVLNAAITMGMV
LLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSFLIK
NT seq 876 nt   +upstreamnt  +downstreamnt
atggaatggagttccaggcgctcaatcttccgaatgaatggcgacaaattcagaaaattt
ataaaggcaccacctcgaaactattctatgattgtgatgttcacagctcttcagcctcag
cggcagtgttctgtgtgcaggcaagcgaatgaagaatatcagatactggctaactcctgg
cgctattcatctgctttctgtaacaaactcttcttcagtatggtggactatgacgagggg
acagatgtctttcaacagctcaacatgaactctgctcctacattcatgcattttcctccg
aaaggcagacctaagagagctgatacttatgaccttcaaagaattggatttgcagctgaa
cagctagccaagtggattgctgaccgaacggatgttcatattcgagtcttcagaccaccc
aactactctggcaccattgctttggccctgttagtgtcacttgttggtggcttgctctat
ttaagaaggaacaacttggagttcatctataacaagactggttgggccatggtatctctg
tgcatagtcttcgctatgacttctggtcagatgtggaaccatatccgtggacctccatat
gcttataagaatccacacaacggacaagtgagctacattcacggaaacagccagggtcag
ttcgtggcagagtcccacattattctggtactaaatgctgctatcaccatggggatggtt
cttctaaacgaagcggcaacatccaaaggagatgttggaaaaagacggattatttgcctg
gtgggcctgggcctggtcgtgttcttcttcagctttctcctctccatattccgctccaag
taccacggctacccctacagctttttaattaaatga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107538427
Entry
107538427         CDS       T05883                                 
Symbol
DDOST
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
  KO
K12670  oligosaccharyltransferase complex subunit beta
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna00513  Various types of N-glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107538427 (DDOST)
   00513 Various types of N-glycan biosynthesis
    107538427 (DDOST)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107538427 (DDOST)
SSDB
Motif
Pfam: DDOST_48kD
Other DBs
NCBI-GeneID: 107538427
NCBI-ProteinID: XP_016070149
LinkDB
Position
Unknown
AA seq 442 aa
MEPGAPARAWSLLWPLLLLLPSLGLVGASGPRTLVLLDNLNLRETHSLFFRSLKDRGFDL
TFKTADDPSLSLIKYGEFLYHNLIIFSPSVEDFGGNINVETISTFIDGGGSVLVAASSDI
GDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSPNP
ILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNAR
VIFSGSLDFFSDAFFNSAVQKATPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHH
RVGEKAPPHAYTVTDLVEYSIVIEQLSNGRWVPFDGDDIQLEFVRIDPFVRTFLKKKGGK
YSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFS
MMAGLFLFSIVFLHMKEKEKSD
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggagcctggcgccccggcccgtgcttggtccctcttgtggccgctgctgctcctgctg
ccctctcttggcctggtcggcgccagcggcccccgcactttagtgctgctggacaacctc
aacctgcgggagacgcattcgcttttcttccggagtctaaaggatcggggctttgatctc
acattcaagaccgcagatgacccgagcctctctcttattaagtacggggagttcctctat
cacaatctcatcatcttctccccctcggtagaagattttggagggaacatcaatgtggag
accatcagtacctttattgacggtggaggcagtgtcctggtagctgccagctcagacatt
ggtgaccctcttcgcgagctgggcagtgagtgtgggattgagttcgatgaggagaaaacg
gctgtcattgaccatcacaactacgacatctcagaccttggccagcataccctcattgtg
gctgacactgagaacctgctgaaggcccccaccattgttgggaaatcgtctccaaatccc
atcctctttcgaggtgttgggatggtggctgaccccgacaaccctttggtgttggacatc
ctgacgggctcttccacctcttactccttcttcccagataaacccatcacccagtatccc
catgcagtggggaagaacaccctcctgatcgctgggctccaggccaggaacaacgcccgg
gtcatcttcagcggctccctcgacttcttcagcgatgccttcttcaactcggcagtgcag
aaggccacgcctggctcccagaggtattcccagacaggcaactatgagctagctgtggcc
ctctctcgctgggtgttcaaagaggagggtgtcctccgtgtggggcctgtgtcccaccat
cgggtgggcgagaaagccccaccccatgcctacactgtcactgaccttgtggagtacagc
atcgtgattgagcagctctctaatggcaggtgggtcccctttgatggtgatgacattcag
ctggagtttgtccgcatcgatccttttgtgaggaccttcttgaagaagaaaggtggcaag
tacagtgtccagttcaagttgccagacgtgtatggtgtgttccagtttaaagtggattac
aaccggctaggctacacacacttgtattcttccactcaggtatcagtgaggccactgcag
cacacgcagtatgagcgcttcatcccttcagcctacccctactacgccagcgccttctcc
atgatggcgggactcttcctcttcagcatcgtcttcttgcacatgaaggagaaggagaag
tcggactga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107542111
Entry
107542111         CDS       T05883                                 
Symbol
RPN2
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 isoform X1
  KO
K12667  oligosaccharyltransferase complex subunit delta (ribophorin II)
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna00513  Various types of N-glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107542111 (RPN2)
   00513 Various types of N-glycan biosynthesis
    107542111 (RPN2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107542111 (RPN2)
SSDB
Motif
Pfam: Ribophorin_II HSM3_N DUF5859 DUF2922 DUF6571
Other DBs
NCBI-GeneID: 107542111
NCBI-ProteinID: XP_016074809
LinkDB
Position
Unknown
AA seq 644 aa
MAPPGVSTVVLLAVAIIASAQALTPTHYLTKHDVERLKASLDRPFTSLESAFYSIVGLSS
LGAQVPDVKKACTFIKSNLDPSNVDSLFYAAQSSQVLSGCEISISNETKDLLLAAVSEDS
SVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSI
VEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTQPSIKEEQVIQLMNTI
FSKKNFDSVSEAFSVASAAAALSQNRYHVPVVVVSEGSPSSTHEQAILRLQVTNVLSQPL
TQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFVNVKLSSGYYDFSVKVEGDNRYIA
NSVELRIKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFVADSHQNFALFFQL
VDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDSKNVYKFELDTSERKIEFDSASGTYT
LYLIIGDATLKNPILWNVADVVIKFPEEDAPSTVLSKNLFTPKQEIQHLFREPEKRPPTV
VSNTFTALILSPLLLLFALWIRIGANVSNFSFAPSTIIFHLGHAAMLGLMYVYWTQLNMF
QTLKYLAILGSVTFLAGNRMLAQQAIKRIAAEQSSRLAKYRTLR
NT seq 1935 nt   +upstreamnt  +downstreamnt
atggcgccgccgggtgtaagcactgttgtcctgttggctgtggcaatcatagccagtgcc
caggctctgacgcccactcactacctcaccaagcatgatgttgaaagactgaaagcttcg
ctggaccgccctttcacaagtttagaatctgctttctactctatcgtgggactcagcagt
cttggtgcccaggtgccagatgtaaagaaagcatgcaccttcattaaatcaaaccttgat
cccagcaacgtggattccctgttctatgctgcccagtccagccaggtcctctcagggtgt
gagatctctatttcaaatgagaccaaagatctgctccttgcagctgtcagtgaagactcg
tctgttacccagatctaccatgcagttgcagccctgagcggctttggccttcccttggct
tcccaagaagcactcagtgcccttactgctcgcctcagcaaggaagagactgtgctggca
acagtccaggcgctgcagacggcatcccacctgtcccagcaggctgacctgaggagcatc
gtggaagagattgaggaccttgttgctcgcctggatgaactgggaggtgtgtatcttcag
tttgaagaaggactggaaacaactgcattatttgtggctgcgacctacaagctcatggac
catgtgggaacccaaccatccattaaggaggagcaggtcatccagttgatgaatacgatc
tttagcaagaagaacttcgactcggtctcagaagccttcagtgtggcctctgctgccgct
gcgctctcccagaatcgctaccacgtgcctgttgtggttgtatccgagggctctccttcc
agcactcatgaacaggcgatcctgcggttgcaggtcaccaatgttctgtcccagcctctg
actcaggccactgttaaactagaacatgctaaatccgttgcttccagagctactgtcctc
cagaagacctctttcacccctgtaggggatgtttttgaactgaattttgtgaatgtcaag
ttgtccagtggttattatgacttctctgtcaaagttgaaggtgacaaccgttatattgca
aatagtgtagagctcaggatcaagatctccactgaagtcggcatcacaaatgtggacctc
tccactgtggataaggaccagagcatcgccccgaaaaccacacgggtgacctacccagcc
aaggccaagggcacgtttgtcgcagacagtcaccagaactttgctttgttcttccagctg
gtagacgtgaacacaggtgctgagctcaccccccaccagacatttgtccgactccataac
cagaagactggccaggaagtggtgtttgttgctgagccggacagcaagaatgtgtacaag
tttgaactggatacttctgagaggaagatcgaatttgactctgcgtccggcacctacact
ctctacttgatcatcggagatgccactttgaagaacccaatcctttggaatgtggctgat
gtggtcatcaagttccctgaggaagatgctccatcgactgtcctatccaagaaccttttc
acccccaagcaggaaattcagcacctgttccgcgagcctgagaagaggccccccacagtg
gtgtctaatacattcactgccctgatcctctcacccttgctcctgctttttgctctgtgg
atccggattggtgccaatgtctccaacttctcttttgctcctagcacgattatctttcac
ctgggacatgctgctatgctggggctcatgtatgtctactggactcaactcaacatgttc
cagaccctgaagtacctggccatcttgggcagtgtgacgtttctggctggcaatcggatg
ctggcccagcaggcaatcaagaggatcgctgcagagcagagcagtagattggcaaaatat
aggacattacggtaa

DBGET integrated database retrieval system