KEGG   Miniopterus natalensis (Natal long-fingered bat): 107525395
Entry
107525395         CDS       T05883                                 
Symbol
SKP1
Name
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
mna04310  Wnt signaling pathway
mna04350  TGF-beta signaling pathway
mna04710  Circadian rhythm
mna05132  Salmonella infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107525395 (SKP1)
   04120 Ubiquitin mediated proteolysis
    107525395 (SKP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107525395 (SKP1)
   04350 TGF-beta signaling pathway
    107525395 (SKP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107525395 (SKP1)
   04114 Oocyte meiosis
    107525395 (SKP1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    107525395 (SKP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525395 (SKP1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107525395 (SKP1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107525395 (SKP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107525395 (SKP1)
   04121 Ubiquitin system [BR:mna04121]
    107525395 (SKP1)
   03036 Chromosome and associated proteins [BR:mna03036]
    107525395 (SKP1)
Membrane trafficking [BR:mna04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107525395 (SKP1)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107525395 (SKP1)
   Cul7 complex
     107525395 (SKP1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107525395 (SKP1)
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107525395 (SKP1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 107525395
NCBI-ProteinID: XP_016053040
LinkDB
Position
Unknown
AA seq 163 aa
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgccttcaattaagttgcagagttctgatggagagatatttgaagttgatgttgaaatt
gccaaacaatctgtgactatcaagaccatgttagaagatttgggaatggatgatgaaggt
gatgatgacccagttcctctaccaaatgttaatgcagcaatattaaaaaaggtcattcag
tggtgcacccaccacaaggatgaccctcctcctcctgaggatgatgagaacaaagaaaag
cgaacagatgatatccctgtttgggaccaagaattcctcaaagttgaccaaggaacactt
tttgaacttattctggctgcaaactatttagacatcaaaggtttgcttgatgttacatgc
aagactgttgccaatatgatcaaggggaaaactcctgaagagattcgcaagaccttcaat
atcaaaaatgactttactgaagaagaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

DBGET integrated database retrieval system