KEGG   Miniopterus natalensis (Natal long-fingered bat): 107526248
Entry
107526248         CDS       T05883                                 
Symbol
XBP1
Name
(RefSeq) LOW QUALITY PROTEIN: X-box-binding protein 1
  KO
K09027  X box-binding protein 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107526248 (XBP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107526248 (XBP1)
   05012 Parkinson disease
    107526248 (XBP1)
   05014 Amyotrophic lateral sclerosis
    107526248 (XBP1)
   05017 Spinocerebellar ataxia
    107526248 (XBP1)
   05022 Pathways of neurodegeneration - multiple diseases
    107526248 (XBP1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107526248 (XBP1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107526248 (XBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107526248 (XBP1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107526248 (XBP1)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 bZIP_Maf KASH_CCD PPP1R26_N YabA Macoilin
Other DBs
NCBI-GeneID: 107526248
NCBI-ProteinID: XP_016054150
LinkDB
Position
Unknown
AA seq 386 aa
MVVVASAQSPAVGAPKVLLLSGKPAAAAAAGAPAGRNVPLMLPGQRGASPEAESGGPPQA
RKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQL
LREKTHGLVVENQELRQRLGIDALVTEEEEETKGNGSRPVAGSAERSTQTTCTSAAGAGP
VVTPPEHLPVDSDSVDSSDSESDILLGILFNLDPVMFLRCPSPESTSLEQLPEVYPEGPS
SLPASPSPSLGTSSAKLEAINELIRFDHVYTKPLVLEMPSETESQPDVVVKIEEAPSSPS
EKDHPEFTVSVKEELVEDDFIPELGIPDLLSSSHCLKSSSCLLDAYSDCRYEGSPSPFSD
MSSLLGVDHSWEDTFANELFPQLISV
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggtggtggtggcatctgcgcaaagcccggccgtcggggcccccaaagtgctgcttctg
tccggcaagcccgccgcagccgccgccgccggagccccggccggccggaatgtgccactc
atgttgccgggccagcgaggggccagcccggaggcagagagcggtgggccaccccaggcg
cgaaagcgacagcgcctcacacacctgagccccgaggagaaggctctgcggaggaaactg
aaaaacagagtagcagctcagactgccagagaccgaaagaaagcccgaatgagtgagctg
gaacaacaagtggtagatttggaagaagagaaccaaaaacttctgctagaaaatcagctt
ttacgagagaaaactcatggccttgtagtggagaaccaggagttaagacagcgcttgggg
atagatgccttggttactgaagaggaggaagagaccaaggggaatggatcgaggccagtg
gccgggtctgctgagcgcagcactcagactacgtgcacctctgcagcaggtgcaggccca
gttgtcacccctccagaacatctccccgtggattctgacagtgttgactcttcagactct
gagtctgatatcctcttgggtattctgttcaacttggacccagtcatgttcctcagatgt
ccttctccagagtctaccagcctggagcagctcccagaggtttacccagaaggacccagt
tccttaccggcctccccttctccatcactggggacgtcatcagccaagctggaagccatt
aatgaactgattcgttttgaccacgtatataccaagcccctagtcttagagatgccctct
gagacagagagccaacctgatgtggtagtgaaaattgaggaagcaccttccagcccctca
gagaaagatcaccctgaattcactgtctcagtgaaggaagaacttgtagaagatgacttc
attccagagttgggtatcccagatctactttcatccagccattgcctgaagtcatcttcc
tgcctactggatgcttatagtgactgtagatatgagggctccccttcccctttcagcgac
atgtcctctttgcttggtgtagaccattcttgggaggacacttttgccaatgaactcttt
ccccagctgataagtgtctaa

DBGET integrated database retrieval system