KEGG   Miniopterus natalensis (Natal long-fingered bat): 107526862
Entry
107526862         CDS       T05883                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 D3-like
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107526862
   04120 Ubiquitin mediated proteolysis
    107526862
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107526862
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107526862
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107526862
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 107526862
NCBI-ProteinID: XP_016054944
LinkDB
Position
Unknown
AA seq 152 aa
MPLKRINEFRNLAHDPPAQCSAGPVGNDVLHWQVTIMGPNGSPNQGCAFFLTTNFPTGYP
FKPPKAAFTRIYHPNINSSGSICLDILRSQWSPASTISKVPLSICSLLCDPNPDDPLVPG
IVQIYKPGRDKYNGISQEWTRSMPCDATLKSE
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcccctgaaacggattaatgagtttagaaatttggcccatgaccctccagcacaatgt
tctgcaggtccagttgggaatgatgtgcttcattggcaagtcacaattatgggacctaat
ggcagcccaaatcaaggctgtgcgttctttttgacaacaaattttcctacaggctacccc
ttcaaaccacccaaggctgcatttacaagaatttatcatccaaatattaacagtagtggc
agcatttgtctcgatattctaagatcacagtggtctcctgcatcaactatttctaaagtt
cctttatccatttgttcactgctatgtgatccaaacccagatgatcccctagtgccaggg
attgtacagatctataaaccaggcagagataagtacaacggaatatctcaggaatggact
cgaagtatgccatgtgatgctactttaaagtcagagtaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107527552
Entry
107527552         CDS       T05883                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 2-like
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107527552
   04120 Ubiquitin mediated proteolysis
    107527552
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107527552
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107527552
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107527552
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 107527552
NCBI-ProteinID: XP_016055825
LinkDB
Position
Unknown
AA seq 184 aa
MASEQQSPDQENPEVAEPAAVQDTGSLAEKTGPVAQSLALKRLQKELLDLSRDPLDFCSA
GPVEEDIFTWQGVLLGPQESPYHGGAFFLSIQFPKEYPFKPPKILFKTRIYHPNVNHNGC
IGLPILNSEWSAGHTISKILLSIHAMLCEPNPHVVLIPEMWEMYIKDRPRYDVLARAWTR
KYAM
NT seq 555 nt   +upstreamnt  +downstreamnt
atggcctctgagcagcagagtccagatcaggagaacccggaggtggcggagccagcagct
gtgcaagacacaggaagcctcgcggagaagactggccccgtggcacagtccctggcccta
aagcgcctccagaaggagctcctcgacctttcccgagaccccctagacttttgctccgca
gggccagtggaagaagatatattcacatggcagggggttttactggggccccaggagagc
ccctaccacggaggagccttcttcctgagtatccaattcccgaaggagtaccctttcaaa
cctcccaagattctattcaaaacccgaatttaccatccgaatgtaaatcataacgggtgc
attggtctgcccatccttaattctgagtggtctgctggacacacaatttctaaaatattg
ctgtcaatccatgccatgttatgtgagcccaacccacacgttgttctgatcccagaaatg
tgggagatgtacataaaagataggccaaggtatgatgtcttggctcgagcatggactagg
aagtatgctatgtaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107527562
Entry
107527562         CDS       T05883                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2-17 kDa-like
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107527562
   04120 Ubiquitin mediated proteolysis
    107527562
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107527562
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107527562
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107527562
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 107527562
NCBI-ProteinID: XP_016055829
LinkDB
Position
Unknown
AA seq 118 aa
MFHWQGYIIGPKDSPYQGGVFILSIRFPKEYPLKPPKVLFKTQIYHPSVNHNGYVSLPIL
NSQWSPAYTVSKILLSISAMLCDPRPQDILVPEMWKMYISDKPKYDVLARAWTRKYAM
NT seq 357 nt   +upstreamnt  +downstreamnt
atgttccattggcagggatatataatagggcccaaggacagcccctaccagggaggagtc
ttcatccttagtatccgattcccgaaggagtaccccttaaaaccaccgaaggtcctattt
aaaacccaaatttatcatcccagcgtaaatcataatgggtatgtcagcctgcccatcctt
aattcccagtggtccccggcatacacagtctccaaaatattgctgtcaatcagtgccatg
ctgtgtgatcccagaccacaagatatcctagttccagaaatgtggaagatgtacataagt
gataagccaaagtatgatgtcttggctcgagcatggactaggaagtatgctatgtaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107527563
Entry
107527563         CDS       T05883                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2-17 kDa-like isoform X1
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107527563
   04120 Ubiquitin mediated proteolysis
    107527563
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107527563
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107527563
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107527563
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 107527563
NCBI-ProteinID: XP_016055830
LinkDB
Position
Unknown
AA seq 109 aa
MTPENPYQGGVFILNMVFPSDYPLKPPQVQFSTPIYHVNINHNGYIGLPILNSEWSPAHT
VSKILLSICDMLCDPNPHDILIPEIGKIYINDRPKYDFMAQEWTKKYAM
NT seq 330 nt   +upstreamnt  +downstreamnt
atgacccctgagaacccctaccagggaggagtcttcatcctaaatatggttttcccatcg
gattaccctttaaaaccaccccaggtccaattcagtaccccaatttaccatgtgaacata
aaccataatgggtatattggtctgcccatccttaattctgagtggtcacctgcacacaca
gtttccaaaatattgctgtcaatctgtgacatgttatgtgatcccaacccacacgatatt
ctgattccagaaattgggaagatttacataaatgataggccaaagtatgatttcatggct
caagaatggacaaagaagtatgctatgtaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107530137
Entry
107530137         CDS       T05883                                 
Symbol
UBE2D2
Name
(RefSeq) ubiquitin-conjugating enzyme E2 D2
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107530137 (UBE2D2)
   04120 Ubiquitin mediated proteolysis
    107530137 (UBE2D2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107530137 (UBE2D2)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107530137 (UBE2D2)
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107530137 (UBE2D2)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 107530137
NCBI-ProteinID: XP_016059289
LinkDB
Position
Unknown
AA seq 147 aa
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDREKYNRIGREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctctgaagagaatccacaaggaattgaatgacctggcacgggaccccccagcacag
tgttcagcaggtcctgttggagatgatatgttccattggcaggctacaataatggggcca
aatgacagtccctatcagggtggagtatttttcttgacaattcacttcccaacagattat
cccttcaaaccacctaaggttgcatttacaacaagaatttatcatccaaatattaacagt
aatggcagcatttgtcttgatattctacggtcacagtggtctccagcactaactatttca
aaagtactcttgtccatctgttctctgttgtgtgatcctaatccagatgatcctttagtg
cctgagattgctcggatctacaaaacagatagagaaaagtacaacagaataggtcgggaa
tggactcagaagtatgcgatgtaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107531636
Entry
107531636         CDS       T05883                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 D2B-like
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107531636
   04120 Ubiquitin mediated proteolysis
    107531636
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107531636
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107531636
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107531636
SSDB
Motif
Pfam: UQ_con UEV RWD
Other DBs
NCBI-GeneID: 107531636
NCBI-ProteinID: XP_016061236
LinkDB
Position
Unknown
AA seq 118 aa
MFKWQGLMLGPKDSPYHGGAFFLSIQFPREYPFKPPKILFKTRIYHPNVNRKGRVSLPIL
NSQWSPAHTLSKILLSISAMLCEPRPQDILVPEMWKMYKNDRPKYNIMAQKWTKKYAM
NT seq 357 nt   +upstreamnt  +downstreamnt
atgttcaaatggcagggacttatgctggggccaaaggacagcccctaccacggaggagcc
ttcttccttagtatccaattcccgagggagtaccctttcaaacctcccaagattctattc
aaaacccgaatttaccatccgaacgtaaatcgtaaaggccgtgtcagcctgcccatcctt
aattcccagtggtctcctgcacacacactttcaaaaatattgctgtcgatcagcgccatg
ttgtgtgagcccagaccacaagatatcctagttccagaaatgtggaagatgtacaaaaat
gacaggccaaagtataatatcatggctcaaaaatggacgaagaagtatgccatgtaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107542057
Entry
107542057         CDS       T05883                                 
Symbol
UBE2D4
Name
(RefSeq) LOW QUALITY PROTEIN: ubiquitin-conjugating enzyme E2 D4
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107542057 (UBE2D4)
   04120 Ubiquitin mediated proteolysis
    107542057 (UBE2D4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107542057 (UBE2D4)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107542057 (UBE2D4)
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107542057 (UBE2D4)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 107542057
NCBI-ProteinID: XP_016074745
LinkDB
Position
Unknown
AA seq 168 aa
MGECTSGQEEEGVEQHPSTRALSPLLMFXELSDLQRDPPAQWSARPVGDDWFCWQATITG
PNDSPYQGGIFFLNIHFPTDYPFKPPKVAFTTKIYHPNIHSNGSICLDVLQSHWSPSLTV
SEVLLSICSLLCDPNPDDPLVPEIAHTYKANREKYNKLAREWTQKYAM
NT seq 507 nt   +upstreamnt  +downstreamnt
atgggagaatgcacttctggccaggaggaggagggagtagagcagcatcccagtactcga
gctctgagccctcttctcatgttctaggaattaagcgacttgcaaagggatcctcctgcc
cagtggtccgcaagacctgtgggagatgactggttctgctggcaggccaccatcactggc
ccgaatgacagtccttaccaaggaggcattttcttcctgaacatccactttcctacagat
tatccgttcaaacccccgaaggttgctttcacgaccaaaatttaccaccccaacatccac
agcaatggcagcatctgtctcgatgtcctgcagtcccactggtctccatcactgacagtg
tccgaagtgctcctatccatctgttccctgctctgcgaccccaaccctgacgaccctctg
gtgccagagatagcccacacctacaaggccaacagagagaagtacaacaaactagcaaga
gagtggacacagaagtatgctatgtaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107542505
Entry
107542505         CDS       T05883                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 D2B-like
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107542505
   04120 Ubiquitin mediated proteolysis
    107542505
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107542505
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107542505
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107542505
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 107542505
NCBI-ProteinID: XP_016075312
LinkDB
Position
Unknown
AA seq 118 aa
MFHWKGYIIGPKDSPYQGGAFFLTIRFPWEYPFKPPKVLFKTQIYHPSINQKGCVGLAIL
NSQWSPAHTVSKILLSISSMLCDPSPHNILVPEIWKTYINDKPKYDAMARAWTKKYAM
NT seq 357 nt   +upstreamnt  +downstreamnt
atgttccactggaagggatatataatagggcccaaggacagcccctaccagggaggagcc
ttcttcctcactatccgattcccgtgggagtaccccttcaaaccacccaaggtcctattt
aaaacccaaatttaccatcccagcataaatcagaaaggatgtgtgggtctggccatcctt
aattcccagtggtcaccagcacacacagtttccaaaatattgctgtctatcagctccatg
ctgtgtgatcccagcccacacaatatcctggttccagaaatttggaagacgtacatcaat
gataagccaaagtatgatgccatggctcgagcatggacgaagaaatacgccatgtaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107543351
Entry
107543351         CDS       T05883                                 
Symbol
UBE2D1
Name
(RefSeq) ubiquitin-conjugating enzyme E2 D1
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107543351 (UBE2D1)
   04120 Ubiquitin mediated proteolysis
    107543351 (UBE2D1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107543351 (UBE2D1)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107543351 (UBE2D1)
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107543351 (UBE2D1)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 107543351
NCBI-ProteinID: XP_016076331
LinkDB
Position
Unknown
AA seq 110 aa
MGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPAL
TVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
NT seq 333 nt   +upstreamnt  +downstreamnt
atggggcctcctgatagcgcatatcaaggtggagtcttctttctcactgtccactttccg
accgactatccttttaaaccaccaaagatcgctttcacaacaaaaatttaccatccaaat
ataaacagtaatggaagtatttgtcttgatatcctgaggtcacaatggtcaccagctctg
actgtatcaaaagttttattgtccatatgttctctactttgtgatcctaatccagatgac
cccttagtaccagatattgcacaaatctataaatcagacaaagaaaaatacaacagacac
gcaagagaatggactcagaaatatgcaatgtaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107545515
Entry
107545515         CDS       T05883                                 
Symbol
UBE2D3
Name
(RefSeq) ubiquitin-conjugating enzyme E2 D3
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545515 (UBE2D3)
   04120 Ubiquitin mediated proteolysis
    107545515 (UBE2D3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107545515 (UBE2D3)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107545515 (UBE2D3)
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107545515 (UBE2D3)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 107545515
NCBI-ProteinID: XP_016079096
LinkDB
Position
Unknown
AA seq 147 aa
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDRDKYNRISREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgctgaaacggattaataaggaacttagtgatttggcccgtgaccctccagcacaa
tgttctgcaggtccagttggggatgatatgtttcattggcaagccacaattatgggacct
aatgacagcccatatcaaggcggtgtattctttttgacaattcattttcctacagactac
cccttcaaaccacctaaggttgcatttacaacaagaatttatcatccaaatattaacagt
aatggcagcatttgtctcgatattctaagatcacagtggtctcctgcattaactatttct
aaagttcttttatccatttgttcactgctatgtgatccaaacccagatgaccccctagtg
ccagagattgcacggatctataaaacagacagagataagtacaacagaatatctcgggaa
tggactcagaagtatgccatgtga

DBGET integrated database retrieval system