KEGG   Miniopterus natalensis: 107530196
Entry
107530196         CDS       T05883                                 

Gene name
TNFSF13B
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 13B
  KO
K05476  tumor necrosis factor ligand superfamily member 13B
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04064  NF-kappa B signaling pathway
mna04672  Intestinal immune network for IgA production
mna05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107530196 (TNFSF13B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107530196 (TNFSF13B)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    107530196 (TNFSF13B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    107530196 (TNFSF13B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107530196 (TNFSF13B)
   04090 CD molecules [BR:mna04090]
    107530196 (TNFSF13B)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Tumor necrosis fators
   107530196 (TNFSF13B)
CD molecules [BR:mna04090]
 Proteins
  107530196 (TNFSF13B)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 107530196
NCBI-ProteinID: XP_016059355
LinkDB
Position
Unknown
AA seq 290 aa
MNDFAEGKQSLLSSCPKRREEMKLKEPVSILPQKESPSVRSSRGGILLALTLLLALVSCC
LTVVSFCRVAALQAELSSLRVELQEHQAEQLPGSPRAGAAAPRAAVREAAAAPSALKGIF
APPASGKSNFSQSIRNKRAIQGPEETVIQDCLQLIADSDMPTIRKGDYTYVPWLLSFKRG
RALEERENKILVKETGYFFIYGQVLYTDSTFAMGHLILRKKVHVFGDEMSLVTLFRCIQN
MPETLPNNSCYSAGIAKLEEGDELQLAIPRGDAKISQDGDATFFGALKLL
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaatgacttcgcagaagggaagcagtcactcctttcttcttgtcctaagcgaagagaa
gaaatgaaactgaaggagcctgtctccatccttccccagaaggaaagcccctctgtccga
tcctccagaggtgggattctgttggccctgaccttgctgctggccttggtgtcctgctgc
ctcacggtggtgtccttctgcagagtggctgccctgcaagcggagctgagcagcctccgg
gtggaactgcaggagcaccaagccgagcagctgccaggctctccccgggccggagcagca
gcccccagggcagctgtgcgtgaggctgcagcagccccctctgcactgaaagggatcttt
gcaccaccagcttcaggaaaaagcaacttcagtcaaagcatcaggaataagcgtgccatt
cagggtccagaagaaacagtcattcaagactgcttgcaactgattgcagacagtgacatg
cctactatacgaaaaggagattacacgtacgttccttggcttctcagctttaaaagagga
agagccctagaagaaagagaaaataaaatcttggtcaaggaaaccggttacttttttata
tatggtcaggttttatacaccgatagcacctttgccatgggacacctaatactgaggaaa
aaagtccatgtctttggggacgagatgagtctggtgactttgttccgatgtattcagaat
atgcctgaaacactaccgaataattcctgttattcagctggcattgcaaagctggaagaa
ggagatgaactccaacttgctatcccccgcggagatgctaaaatatcacaggacggagat
gctactttttttggtgcattgaaacttctgtga

DBGET integrated database retrieval system