KEGG   Miniopterus natalensis (Natal long-fingered bat): 107530680
Entry
107530680         CDS       T05883                                 
Symbol
ERN1
Name
(RefSeq) serine/threonine-protein kinase/endoribonuclease IRE1
  KO
K08852  serine/threonine-protein kinase/endoribonuclease IRE1 [EC:2.7.11.1 3.1.26.-]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04140  Autophagy - animal
mna04141  Protein processing in endoplasmic reticulum
mna04210  Apoptosis
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107530680 (ERN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107530680 (ERN1)
  09143 Cell growth and death
   04210 Apoptosis
    107530680 (ERN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107530680 (ERN1)
   05012 Parkinson disease
    107530680 (ERN1)
   05014 Amyotrophic lateral sclerosis
    107530680 (ERN1)
   05016 Huntington disease
    107530680 (ERN1)
   05017 Spinocerebellar ataxia
    107530680 (ERN1)
   05022 Pathways of neurodegeneration - multiple diseases
    107530680 (ERN1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107530680 (ERN1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107530680 (ERN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107530680 (ERN1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107530680 (ERN1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-
     107530680 (ERN1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  IRE family
   107530680 (ERN1)
SSDB
Motif
Pfam: Pkinase Ribonuc_2-5A PK_Tyr_Ser-Thr Pkinase_fungal Kdo APH PQQ_2 PQQ SDP_N
Other DBs
NCBI-GeneID: 107530680
NCBI-ProteinID: XP_016060063
LinkDB
Position
Unknown
AA seq 858 aa
MGKKQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNA
TYFDYAASLPEDDMDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGL
RKVMHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASP
SMVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDLKFNPGLKGKNKLNYLRN
YWLLIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVIHLVDRTSENAPTT
VSQDVGEKLAHAPSRPEAPMDSMLKDIATIILSTFLLIGWVAFIITYPLSMHQQQQLQHQ
QFQKELEKIQRLQQQQLPFHAPGDVAQDAELLDSSGLYSESSGASSPSTSPRASNHSLHS
SSSASRAGTSPFPEQDDEDEETSMVMIGKISFCPRDVLGHGAEGTIVYRGMFDNRDVAVK
RILPECFSFADREVQLLRESDEHPNVIRYFCTERDRQFQYIAIELCAATLQEYVEQKDFA
HLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILLSMPNAHGRIKAMISDFGLCKKLA
VGRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSL
QRQANILLGAYSLDCLHPEKHEDVVARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQL
QFFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRD
LLRAMRNKKHHYRELPVEVRETLGSLPDDFVRYFTSRFPHLLSHTYRAMELCSHERLFQP
YYFHPPPEPQPPVTAEAL
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgggtaaaaagcaggacatttggtatgtcattgaccttctgaccggggagaagcagcag
actttgtcatcggcctttgcagatagcctctgcccttcaacctctcttctgtatcttggg
cgaacagaatacaccatcaccatgtatgacaccaagacccgagagctccggtggaatgcc
acctacttcgactacgcagcctcgctgccagaggacgacatggactacaagatgtcccat
tttgtgtccaatggcgatgggctggtggtgactgtggacagcgagtctggtgatgtcctg
tggatccaaaactatgcttcccccgtggtggccttttatgtctggcagcgggaggggctg
aggaaggtgatgcacatcaacgtcgctgtggagaccctgcgctacctgaccttcatgtcg
ggggaggtggggcgcatcaccaagtggaagtaccccttccccaaggagacggaggccaag
agcaagctgacgcccaccctgtatgttgggaaatactctactagcctctacgcctccccc
tcaatggtccatgagggggtcgccgttgtgccccgaggcagcactcttcctttgctggaa
gggccgcagactgacggtgtcactattggggacaaaggggagtgtgtgatcacacccagc
actgacctaaagtttaaccctgggctcaaagggaagaacaagctcaactacttgaggaac
tactggctcctgattgggcaccatgaaacaccgctgtctgcgtctaccaagatgctggag
agattccccaacaatctgcccaaacaccgggaaaatgtgattcctgccgactcagagaaa
aagagctttgaggaagttatccacctggttgaccggacttcagagaacgcgcccaccacc
gtttctcaggatgtgggggagaagttagctcatgccccctccaggcccgaggcccccatg
gactccatgctcaaggacatcgctaccatcatcctgagcaccttcctgctcatcggctgg
gtggccttcatcatcacctatcccttgagcatgcatcagcagcagcagctccagcaccag
cagttccagaaggaactggagaaaatccagcgcctgcagcagcagcagctgcccttccac
gcacctggagacgtggctcaggacgccgagctcctggactcttccggcctgtactcggag
agctcgggcgccagcagccccagcacgtcccccagagcctccaaccactcgctgcactcc
agcagctctgcctccagggccggcaccagccccttcccggagcaggacgatgaggatgag
gagaccagcatggtgatgattgggaaaatttcattctgtcccagggacgttctaggccat
ggagcggagggcacaattgtgtaccggggcatgttcgacaaccgcgacgtagcagttaag
aggatccttcccgagtgcttcagtttcgccgaccgcgaggtccagctgctgcgagaatct
gacgagcacccgaacgtgatccgttacttctgcacggagagggaccggcagttccagtac
atcgccatcgagctgtgcgccgccactctgcaggagtacgtggaacagaaggacttcgcc
cacctcggcctggagcccatcaccctgctgcagcagaccacctccggcctggcccacctg
cactccctcaacattgttcacagagacctgaagccccacaacatcctcctctccatgccc
aatgcacacggcaggatcaaggccatgatctccgacttcggcctctgcaagaagctggca
gtgggcaggcacagcttcagccgccgttcaggggtgccgggcacggaaggctggatcgcc
ccagagatgctgagcgaagactgcaaggagaaccccacctacacagtggacatcttctct
gcgggctgcgtgttttactacgtgatttctgagggcagccaccctttcggcaagtccctg
cagcgacaggccaacatcctcctgggcgcctacagcctcgactgcttacaccccgagaag
cacgaagacgtcgtcgcccgggagctaatagagaagatgatcgcaatggaccctcagaag
cgcccgtcggcgaagcacgtgctgaaacacccgttcttctggagcctggagaagcagctc
cagttctttcaggatgtgagtgaccgaatagaaaaggagtccctggacggcccgatcgtg
aagcagctggagagaggcgggagagctgtggtgaagatggactggagggagaacatcact
gtccccctgcagacagatctgcgtaaattcagaacctataaaggtggctccgtcagagat
ctcctccgagccatgcgaaataagaagcaccactaccgggagctgcccgtggaggtgcgg
gagaccctgggctccctccccgacgacttcgtgcgctacttcacgtcgcgcttcccccac
ctcctctctcacacctaccgggccatggagctgtgcagccacgagaggctcttccagccc
tactacttccacccgcccccggagcctcagccccccgtgactgcagaggccctctga

DBGET integrated database retrieval system