KEGG   Miniopterus natalensis: 107530895
Entry
107530895         CDS       T05883                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
mna  Miniopterus natalensis
Pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04512  ECM-receptor interaction
mna04514  Cell adhesion molecules
mna04640  Hematopoietic cell lineage
mna04810  Regulation of actin cytoskeleton
mna05145  Toxoplasmosis
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05222  Small cell lung cancer
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107530895 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107530895 (ITGA6)
   04514 Cell adhesion molecules
    107530895 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107530895 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107530895 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107530895 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530895 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107530895 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107530895 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107530895 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107530895 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107530895 (ITGA6)
   05414 Dilated cardiomyopathy
    107530895 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107530895 (ITGA6)
   04515 Cell adhesion molecules [BR:mna04515]
    107530895 (ITGA6)
   04090 CD molecules [BR:mna04090]
    107530895 (ITGA6)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107530895 (ITGA6)
  Exosomal proteins of breast milk
   107530895 (ITGA6)
Cell adhesion molecules [BR:mna04515]
 Integrins
  Integrin alpha subunits
   107530895 (ITGA6)
CD molecules [BR:mna04090]
 Proteins
  107530895 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 DUF4381
Other DBs
NCBI-GeneID: 107530895
NCBI-ProteinID: XP_016060346
LinkDB
Position
Unknown
AA seq 977 aa
MGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDEMDGGDWSF
CDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFED
GPYEVGGETDHDESLVPVPANSYLGFSLDSGKGIVSKDDITFVSGAPRANHSGAVVLLKR
DMKSAHLLPEHIFEGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEIGGAVYVY
MNQQGRWKNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDNGKVFIYHGSA
NGINTKPTQVLEGNSRFFGYSIAGNMDLDRNSYPDVAVGSLSDSVTVFRSRPVINIQKTI
TVTPSTIDLRQKTACGAPSGICLKVKACFEYTAKPTGYNPSISIIGTLEAEKERRKSGLS
SRVQFRNQGSEPKYTKEITLNKQKQKVCMEETLWLQENIRDKLRPIPITASVEIQEPTTR
RRVNSLPEIFPILNSNEPKTAHKDVHFLKEGCGDDNVCNSNLKLEYKFCSREGSQDKFSY
LPIQKGLPELVLKDQKDIALEITVTNGPSDPKNPTKDGDDAHEAKLIATFPDTLTYSAYR
ELKAFPEKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLE
TTSNQDNLASITASAKVVIELLLSVSGVAKPSQVYFGGTVLGEQAMKSEDEVGSLIEYEF
RVINLGKPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKIACEPQNEINFLNLKE
SHNSRRKREIAEKQIEDRRKFTLFAERKYQTLNCSVNVNCVNLRCPLRGLDSKASVILRS
RLWNSTFLEEYSKMNYLDILVRASIDITAATENIKLSNAGTQVRVTVFPSKTAALHSGVP
WWIILVAILAGILMLALLVLLLWKCGFFRRSRYDDSIPRYQAVKIPKEEREINDEKHSDN
PEKKQWVTRWNENESYS
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgggggtcaccgtccagagccagggtcccggcggcaaagttgtgacatgtgctcatcga
tatgaaaaaaggcaacacgttaatacaaagcaggaatcccgggacatctttggaaggtgt
tacgtcctgagtcagaacctcaggattgaagatgagatggatggaggagactggagtttt
tgtgatggccgactgagaggccatgaaaagtttggttcttgccagcaaggtgtagcagct
acttttactaaagacttccattacattgtatttggagccccgggcacttataactggaaa
gggattgttcgcgtagaacaaaagaataacactttttttgacatgaacatctttgaagat
gggccttacgaagttggtggagagactgaccatgatgaaagtctagttcctgttcctgct
aacagttacttaggcttttctttggactcgggaaaagggattgtttctaaagatgacatc
acttttgtatctggtgctccgagagccaatcacagtggagctgtggttttgctgaaaaga
gacatgaagtccgcacaccttctccccgagcacatatttgaaggagaaggtctggcgtct
tcatttggctatgatgtggcggtggtggaccttaacaaagacgggtggcaagatatagtt
attggagccccacagtattttgatagagatggagaaattggaggcgcagtgtatgtctac
atgaaccagcagggccggtggaaaaatgtgaagccaattcgtcttaatggaaccaaagac
tccatgtttggcattgccgtcaaaaatattggtgacattaatcaagatggttacccagat
attgcagttggagctccctatgatgataatggaaaggtttttatctatcacggatctgcg
aacggaataaataccaaaccaacccaggttcttgaaggtaattcacgcttttttggatat
tcaattgctggaaatatggaccttgatagaaattcctaccctgatgttgctgttggctcc
ctgtcagactcagtaactgttttcaggtcccgccctgtgattaatatccagaaaaccatc
acagtaacacccagcacgattgacctccgccagaaaacagcctgtggggcccccagcggg
atctgcctcaaggttaaggcctgctttgaatatacggccaaacccactggttacaatcct
tcaatatccattataggcacacttgaggctgaaaaagagagaagaaaatctgggctgtca
tcaagagttcagtttcgaaaccaaggttctgagcccaagtatactaaagagataactctg
aacaagcagaagcagaaggtgtgcatggaggaaaccctctggctacaggaaaatatcaga
gataaactgcgtcccatccccataactgcttcagtagagatccaagagccaaccactcgg
aggcgagtgaattcacttccagagatttttccaattctgaattcaaatgagcccaagaca
gctcataaagacgtgcacttcttaaaagagggatgtggagatgacaacgtatgtaacagc
aaccttaaactagaatacaaattttgctcccgagaaggaagtcaggacaagttttcttat
ttaccaattcaaaaagggcttccagaactagtcctgaaggaccagaaggacattgcttta
gaaataacagtgacaaacggcccttctgacccaaagaatcccaccaaagatggggatgat
gcacacgaagctaaactcattgcaacttttccagacactctgacttactctgcatacaga
gagctgaaggctttccctgagaagcagttgagttgtgttgccaaccagaatggctcacaa
gcagactgtgagctcggaaatccttttaaaagaaattccagtgttactttttatttgatt
ttaagtacaaccgaggtcacctttgacaccacagatctggatattaatctgaagttggaa
acaacaagcaatcaggataatttggcttcaattacagcttctgcaaaagtggttattgaa
ctgcttttatcggtctctggagttgctaaaccttcccaggtgtattttggagggacagtc
cttggtgagcaggctatgaaatctgaagatgaagtgggaagtttgatagagtatgagttc
agggttattaacttgggcaagcctcttaaaaaccttggcacagcaaccttgaatatccag
tggccaaaagaaattagcaacggcaaatggttgctttatttggtgaaagtagaatccaaa
ggattggaaaagatagcttgtgagccgcaaaatgaaataaactttctgaacctaaaggag
tcacacaactcaagaaggaaacgggaaattgccgagaaacagattgaggatagaagaaaa
tttactttgtttgctgaaagaaaataccagacccttaactgcagcgtcaacgtgaactgc
gtgaacctcaggtgcccgctgcgcggcctggacagcaaggcctctgttattttgcgctcg
aggttgtggaacagcacatttctagaggaatattctaaaatgaactacttggacattctc
gtgcgggcttccattgacataactgctgccaccgagaatatcaagttgtcaaacgcaggc
actcaggttcgtgtgactgtgtttccctcgaagactgcagctctacattcaggagtacct
tggtggatcatcttagtggctattcttgctggaattttgatgcttgctctattagttctt
ttattatggaagtgtggattcttcagacgctctaggtacgacgacagcatcccccgatac
caggccgtaaagatccccaaagaagagcgggagatcaacgacgaaaaacacagcgacaac
ccggagaaaaagcagtgggtcacgaggtggaacgaaaatgaaagctactcctag

DBGET integrated database retrieval system