KEGG   Miniopterus natalensis (Natal long-fingered bat): 107531903
Entry
107531903         CDS       T05883                                 
Symbol
PPP1R15A
Name
(RefSeq) protein phosphatase 1 regulatory subunit 15A
  KO
K14019  protein phosphatase 1 regulatory subunit 15A
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107531903 (PPP1R15A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107531903 (PPP1R15A)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107531903 (PPP1R15A)
SSDB
Motif
Pfam: PP1c_bdg
Other DBs
NCBI-GeneID: 107531903
NCBI-ProteinID: XP_016061584
LinkDB
Position
Unknown
AA seq 794 aa
MAPSQVPHQFPWRDAHSFFLLSPLMGFLSRAWSRLRGPGPPKPWLVEAVMSADQGEAGPE
GEMKAALATYYPPWGGHPRGEPGDSGTAMEDGQSSWGTCPDLKANSSLPEAWGLSDKNDD
EQGGKEAASIPMLLFGGQSAPWSPSLPRTLPDAPGEKGSEDAGVAEDKAIMFFTVPPSHW
ECCPGLEGEGGEAVNQVPRTPASPSSPGSRPRAWVYCSGEEEAQAKEEERTEKKETRKTS
TSPSPVGSHPGVWECYSGQGPEEAHGGADPEPHASVLGPRPLHGTWQHQPNKIPVEDEEE
EGEDSVSVEAEGPSATTSTSAFIKAWVCLPGEDTEDSEEDSDWGTAGEEGEAEGPSAIPP
TSAFLRSWVHRPGEDSEEDSDDSGTAGEEGEAEGPFAIPPTSAFLRAWVHQPGEDSEEDS
DDSGTAGEEGEAEGPFSFPPTSAFLRSWVHRPGEDSEEDSDDSGTAGEEGEAEGPFAIPP
TSAFLRAWVHQPGEDSEEDSDDSGTAGEEGEAEGPFSFPPTSAFLRSWVHRPGEDSEEDS
DDSGTAGEEGEAEGPSAIPPTNAFLRAWVHRPGEDSEEEEEDSDDWGTAGSGASSSLWAQ
SAFRGWTYPPGKETEGGDAAEEWGEAEPFRVAIYLPGEKPPLPWALPRLPLRLQRRLKSA
ETPTQHLDPETPQKARKVRFSEKVSIHFLVVWAGPAQAARRGPWEQFARDRSRFARRIAQ
AQEKLGPCLTPAARARAWARLGNPPPASLAAPAATTQTLPASSVQAMPLSHAVAAPSPLY
VSVSPCLDLSGRRG
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggccccaagccaggtaccccatcagttcccctggagggatgcccactccttcttcctt
ctgtccccactgatgggctttctcagccgggcatggagccggctgcggggcccaggacct
ccaaagccctggctggtggaagcagtgatgagtgcagatcagggagaagctggcccagag
ggagaaatgaaggcagctttggccacctactatcccccctggggcgggcaccctcggggg
gagcctggagacagtggaacagccatggaggatggacagtcatcctgggggacctgccct
gacctaaaagccaacagttctcttcctgaagcctggggcctttcagacaaaaatgatgac
gagcagggtgggaaagaagcagccagcatccccatgttgctatttggtggccagtctgct
ccctggtcccccagccttccgagaaccctgccagatgctcctggggagaagggatctgag
gacgcaggagttgctgaagataaagccatcatgttcttcactgttcctccatcccactgg
gaatgttgtccagggctggagggggagggtggagaagctgtaaatcaagttcccagaaca
cctgcttccccctcatctccaggatccaggcccagagcctgggtgtattgctcaggggag
gaagaggctcaagccaaggaggaagaaagaacagagaagaaagaaaccaggaagacctcc
acttccccttcacctgtaggctcccaccctggcgtgtgggaatgttactcaggacagggc
cctgaggaggcgcatggaggtgctgacccagagccacatgcctcagttctaggccccagg
cccctgcatgggacctggcagcaccagcccaataagatcccagtggaagatgaggaagag
gagggtgaagacagcgtgtcagtggaagctgagggtccgtctgccaccacctccacaagt
gctttcataaaggcctgggtgtgtctgccaggagaggacacagaggactccgaggaagac
agtgattggggaacagctggggaggagggagaagctgagggtccctctgccatccccccc
acaagtgccttcttgaggtcctgggtgcaccgaccaggagaggactccgaggaggacagt
gatgattcaggaacagctggggaggagggagaagctgagggtccctttgccatccccccc
acaagtgccttcttgagggcctgggtgcaccaaccaggagaggactccgaggaggacagt
gatgattcgggaacagctggggaagagggagaagctgagggacccttttccttccccccg
acaagtgccttcttgaggtcctgggtgcaccgaccaggagaggactccgaggaggacagt
gatgattcaggaacagctggggaggagggagaagctgagggtccctttgccatccccccc
acaagtgccttcttgagggcctgggtgcaccaaccaggagaggactccgaggaggacagt
gatgattcgggaacagctggggaagagggagaagctgagggacccttttccttccccccg
acaagtgccttcttgaggtcctgggtgcaccgaccaggagaggactccgaggaggacagt
gatgattcaggaacagctggggaggagggagaagctgagggaccctctgccataccccct
acaaatgccttcttgagggcctgggtgcaccgaccaggagaggactccgaggaggaggag
gaggatagtgatgattggggaacagctggctcgggggcaagttcttccctttgggcccag
agtgccttcaggggctggacatacccacctgggaaggagacagagggaggagatgctgct
gaggagtggggagaagctgagcccttccgagtggccatctatttaccaggagagaagcca
ccacttccctgggctcttcctcggctgcccctccgactgcaaaggcggctcaagtctgca
gaaacccccacccagcatctggatcccgagactccccaaaaggccagaaaggtgcgcttc
tctgagaaggtctccatccatttcctcgttgtctgggctggacctgcccaggctgcccgc
cggggcccctgggaacagtttgcccgggatcgaagcagatttgcccgccgaattgcccag
gctcaggagaagctaggcccctgcctcacccctgcagcacgggccagggcctgggcacgc
ctcgggaaccctccccccgcttctctggctgctccagctgccactacccagaccttgccc
gcatcctctgtgcaggccatgcccttgagccatgctgtggctgctccctccccactttac
gtgtctgtctctccctgcctagacctcagtgggaggcgtggctag

DBGET integrated database retrieval system