KEGG   Miniopterus natalensis (Natal long-fingered bat): 107533639
Entry
107533639         CDS       T05883                                 
Symbol
SYVN1
Name
(RefSeq) E3 ubiquitin-protein ligase synoviolin isoform X1
  KO
K10601  E3 ubiquitin-protein ligase synoviolin [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107533639 (SYVN1)
   04120 Ubiquitin mediated proteolysis
    107533639 (SYVN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107533639 (SYVN1)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107533639 (SYVN1)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107533639 (SYVN1)
SSDB
Motif
Pfam: zf-RING_2 zf-rbx1 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_3 zf-RING_16 zf-RING_5 zf-RING_11 Prok-RING_4 zf-ANAPC11 zf-RING_15 zf-RING-like zf-C3H2C3 zf-HC5HC2H FANCL_C Endonuclease_7
Other DBs
NCBI-GeneID: 107533639
NCBI-ProteinID: XP_016063907
LinkDB
Position
Unknown
AA seq 640 aa
MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKV
MGKVFFGQLRAAEMEHLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLA
EDRVDFMERSPNISWLFHCRIVSLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAI
LMTMVLTIFIKYVLHSVDLQSENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTF
PLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVT
GAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPTQSPPPPEPADQGPPPAPHPP
PLLPQPPNFPQGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAAAPPSTSAAALSRPSGA
ATTTAASAASATAPGSAPTSEAAPTPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTP
EELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNPTEET
TPTVVAAASSTSTPSSDATTPSPGASPPAPEPEKPPGSCGQPTGVSVRVRQRTSLCSTSD
FSLSPAPESVGTEELPEDGEPDAAELRRRRLQKLESPVAH
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgttccgcaccgcagtgatgatggcggccagcctggcgctgacaggagcagtggtggct
cacgcctactacctcaagcaccagttctaccccactgtggtgtacttgaccaagtccagc
cccagcatggcagtcctgtacatccaggccttcgttcttgtcttcctcttgggcaaggtg
atgggcaaagtgttctttggacaactgagggcagcagaaatggagcaccttctggaacgt
tcctggtatgcagtcactgagacttgtctggccttcactgtctttcgggatgacttcagc
ccccgctttgttgcgctcttcactctccttctcttcctcaagtgttttcactggctggct
gaggaccgtgtggattttatggaacgcagccccaatatctcctggctctttcactgccgc
attgtctcccttatgttcctcctgggtatcctggacttcctcttcgtcagccatgcctat
cacagcatcctgacccgtggggcctctgtgcagctggtgtttggctttgagtacgccatc
ctgatgactatggtgctcaccatcttcatcaagtacgtgctgcactccgtggacctccag
agcgaaaacccttgggacaataaggctgtgtacatgctctacacagaactgtttacaggg
ttcatcaaggttctgctatacatggctttcatgaccattatgatcaaggtgcataccttc
cctctgtttgccatccggcctatgtacctggccatgaggcagttcaagaaagctgtgaca
gacgccatcatgtctcgccgagctatccgcaacatgaacacattgtacccagatgccacc
ccagaggaactccaggcaatggataatgtatgtatcatttgtcgagaagagatggtgact
ggtgccaagagactgccctgcaaccacattttccataccagctgcctgcgctcctggttc
cagcggcagcagacctgccctacctgccgtatggatgttcttcgtgcatcactgccaact
cagtcaccaccaccccctgaacctgcggatcaggggccaccacctgccccccacccccca
ccactcctgccgcagccccccaacttcccccagggcctcctgcctccctttcctccaggc
atgttcccgctgtggccccccatgggcccctttccacctgtcccacctccccccagctca
ggagaggctgcagcccctccatccaccagtgcagcagccctttctcggcccagtggagca
gccacaaccacagctgcttctgctgcctctgccacagcacctggctctgcccccacctcc
gaggctgcccccactccagggttccccttcccccctccctggatgggcatgccactgcca
ccaccgtttgccttccccccaatgcctgtgccccctgctggctttgctgggctgacccca
gaggagcttcgggctttggaaggccatgagcggcagcacctggaggctcggctgcaaagc
ctgcgcaacatccacacgctgctggacgctgccatgctgcagatcaaccagtacctcact
gtgctcgcctccttggggcccccccggcctgccacctcagtcaaccccactgaggagact
acccctacagttgtcgccgctgcctcctccaccagcacccccagctctgacgccactacc
ccatccccaggagcttccccaccagccccagaacctgaaaagcctccaggtagttgtggt
cagcctacgggtgtgagtgtgagagtgaggcagaggacttctctgtgttccacttctgat
ttctctctgtccccagcgcctgagtcagtgggcaccgaggagctgcctgaggatggggag
cctgatgcagcagagctccgccgccgccgcctgcaaaagttggagtcccctgttgcccac
tga

DBGET integrated database retrieval system