KEGG   Miniopterus natalensis: 107535206
Entry
107535206         CDS       T05883                                 

Gene name
TTN
Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107535206 (TTN)
   05414 Dilated cardiomyopathy
    107535206 (TTN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107535206 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107535206 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107535206 (TTN)
   04147 Exosome [BR:mna04147]
    107535206 (TTN)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107535206 (TTN)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107535206 (TTN)
Membrane trafficking [BR:mna04131]
 Others
  Actin-binding proteins
   Others
    107535206 (TTN)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     107535206 (TTN)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107535206 (TTN)
SSDB
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 Ig_6 C2-set_2 Receptor_2B4 Pkinase Titin_Z C1-set PK_Tyr_Ser-Thr Adeno_E3_CR1 THB Ig_4 PPAK
Other DBs
NCBI-GeneID: 107535206
NCBI-ProteinID: XP_016066098
LinkDB
Position
Unknown
AA seq 33515 aa
MATQAPTFKQPLQSVVVLEGSAATFEAHISGLPVPEVSWFRDGQVISTSTLPGVQISFSD
GRARLTIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFVQRLQSMTVRQGSQ
VRLQVKVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEVVPAKKTKTIISTAQISETRQTRIEKKIEAHFDARSIATVEMV
IDGATGQQLPHKTPPRIPPKPKSRSPTPPSISAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRPVSPAGRISTSPIRSVKSPSPIRKAQTPTMGQGPEVPPPWKQEGYVASSESEMRE
TMVTSATQIRREERWEGRYGVQEQMTISGAAGAAAGISAGEVKQETDKSAAVATVVAAVD
MARVREPGISAVEQTAQRTTTTAVHIPPAQEQMRKEAETSAVTKAVMAADKAKEQELKSR
TREVITTKQEQVHVTHEQIRKETEKAFVPKVVISTTKAKEQETRISGEITTKQEQKQVTQ
ETIRQTAETTAASMVVVATAKPTKLETILGAREEIATKQDQMHITHEKIMKETRKTVVPK
VIVATPKVKEQDLVSRSREGITTKREQVQITQEKIRKEAEKIALSTIAVATAKAKEQETI
LRTREGMATRQEQIQVTHGKMDAEKKAEAVATVVAAVDQARVREPREPGHVEESYAQQTT
LEYGYKEHVSTTKVAEQPQRPASEPHVVPKAVKPRVIQAPSETHITTTDQMEMHISSQIK
KTTDVTTERLVHVDKRPRTASPHFTVSKISVPKTEPGYEASIAGSAIATLQKELSATSSQ
KITKSVKAPTVKPGETRVRAEPTPSPQFPFADTPETYKSQAGIEVKKEVGVSITDGTVRE
ERFEVLHGREAKVTEKARVPAPAEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPK
VTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ
VSEEFEKETTAVTEKYTTEEKRFVESRDVVMTDTSIVEERAEPGEPSAPFFISKPVVQKL
VEGGSVVFECQVGGNPKPHVYWKKSGVPLTTGYRYKVIYNKQTGECKLVISMTLADDAGE
YTIVIRNKHGETSASASLLREADYDSLMKSQQEMFYQTQMTAFVQEPKVGEIAPGFGYAD
YEKEYEKEQALIRKKMAKDTVLVRTFVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEE
DGEEKMAVDISESEAVEAGFDLRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKH
GERYQMDFLPDGRASLRIPVVLPEDEGIYTAFASNMKGNAICSGKLYVEPAAPLSAPMYI
PTPEPMSRIRSVSPRSVSRSPIRMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPV
FVLKPASFKCLEGQTARFDLKVVGRPMPETFWFHNGQQVINDYTHKVVIKEDGTQSLIIV
PTAPSDSGEWTVIAQNRAGKSSISVTLTVEAVEHQVKPVFVEKLKNVNVKEGSRLEMKVR
ATGNPNPDIVWLKNSEIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGR
DTTRCKVNVEVEFAEPEPERRLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKE
KQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFG
YCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEETQLPEGRKGLQRIEE
LERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPHPKVNWYLNG
QLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSV
LRRAPEPKPEFHIHEPGKLQFEVQKVDRPVDTTEAKEIVKLKRAERITHEKVPEESEELR
SKFKRRTEEGYYEAITAVELKSRKKDESYEELLKKTKDELLHWTKELTEEEKKALVEEGK
ITIPTFKPDRIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKI
ERSDRVYWYWPEDNVCELVIRDVTTEDSASIMVKAINIAGETSSHAFLLVQAKQLITFIQ
ELQDVVAKEKDTMATFECETSEPFVKVKWYKDGVEIHSGDKYRMHSDRKVHFLSVLTIDT
ADAEDYSCVLVEDENVKTTARLTVEGAVIEFVKELEDIEVPESFSGELECIISPENIEGK
WYHNDVELKSNGKYSITSRRGRQNLTVKDVAKEDQGEYSFVVDGKKTTCKLKMKPRPIAI
LQGLSDQKVCEGDIVQLEVKVSLENVEGIWMKDGQEVQPSDRVHVVIDKQSHMLLIEDMT
KEDAGNYSFTIPALEMSTSGRVSVYSVDVITPLKDVNVLEGTKAVLECKVSVPDVTSVKW
YLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYTLMVGRVETSCNLSVEKIKIIRG
LNDLTSTETQNVVLEVELSHSGIDVLWKFKDKEIKPSSKYKIEAHGKIYKLTVQNMMKDD
EGEYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFECEVANPDSEGEWLKDGKH
LPLSNNIRSESDGHKRRLIIASTKLDDIGEYTYKVATSKTSANLKVEAVKVKKTLKNLTV
TETQDAVFTIELTHPNVKGIQWIKNGVVLESNDKYDISVKGTVYSLRIKNCAMVDESVYG
FKLGKLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKNVEIKPSD
KHRLVSERKVHKLMLQHIAPSDAGEYTAVVGQLECKAKLFVETLHITKTMKSIEVPETRT
ASFECEVSHFNVPAMWLKNGVEIEMSEKFKIVVQGKLHQLMIMNTSTEDSAEYTFVCGND
QVSATLKVTPIMITSMLKDINAEEKDTITFEVTVNHEGISYKWLKNGVEIKSTDRCQMRT
KKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFE
CEVSEPDITVQWMKDGQELQIVDRIQIQKEKYVHRLLIPSTRMSDAGQYTVVAGGNMSTA
NLFVEGRDVRIRSIKKEVQVIEKQRAVIEFEVNEDDVDAHWYKDGIEINFQIQERHEYVV
ERRIHRMFISETRHSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPITVQSGKPARF
CAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYG
VATTSASLSVEVPEVVSPDQEMPAYPPAIVTPLQDTVTSEGQPARFQCRVSGTDLTVSWY
SKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVANNAVGQVSSTANLRLEAYES
ILHERIEQQIEVEMKAAPVIKRRIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYE
SDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFFSRPK
SVTTFVGKTAKFLCTVTGTPVIETIWQKDGAALSPSPNRKISDAENKHSLELSNLTIQDR
GVYSCMASNKFGADICQAELIIIDKPHIIKELEPVQSAINKKIHLECQVDEDRKVTVTWN
KDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTYVCTASNEAGSSSSSATVTIREPPS
FVKKVDPSYLMLPGESARLHCKLKGSPGIQVTWFKNNKELNESSTVRMSFAHSEAILDIT
DVKVEDSGTYSCEAVNDVGSDSCSAEIVIKEPPSFVKTLEPADIVRGTNALLQCEISGTG
PFEISWFKDKKQIRSSKKYRLFSQKSLVSLEIFSFNSADVGEYECVVANEVGKCGCSATH
LLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPISVTWMKGQEIIKEDGKIKMSFSKGV
AVLIIPDVQINLGGKYTCLAENEAGSQTSAGELIVKEPAKIVERAELIQVTAGDPATLEY
TVTGTPELKPKWYKDGRPLVASKKYRISFKNSVAQLKFYSAELQDSGQYTFEISNEVGSS
SCETTFTVLDRDIAPFFTKPLRNMDSVVSGTCRLDCKIAGSLPMRVSWFKDSKEIAASDR
YRIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPASKDVL
PGSAVCLKSTFQGSVPLTIRWFKGDTELVSGGSCYITKEALESSLELYSVKTSDSGTYTC
KVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKKGDATQLVCKVTGTPPIKIRWFVNDR
EIKESSKHKMSFVESTAVLKLTDVAVEDSGEYMCEAQNEAGSDHCGSILIVKESPYFTKE
FKPVEVLKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFIQDRLVSLQILKFAAA
DAGEYQCRASNDVGSGTCSARVTLREPPTFVKKIESTSSLRGGTAAFQATLKGSLPITVT
WLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEP
ATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWYKDGQELTLGQKYKISVTDTVSILKI
ISTEKRDSGEYTFEVQNDVGRSSCKASINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIV
SGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEIRHLESIDTGTYTCSATNKAGHNQC
SGHLMVKEPPYFVEEPQSQDVNPSARVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWK
DDTSTVLELFSAKAAHSGTYICQLSNNVGIATSKATLFVKEPPQFVKKPSPVLVLRNGQS
TTFECQITGTPEIRVSWYLDGNEITAIEKHGISFINGLATFQISSARVENSGTYVCEARN
DAGTASCSIELKVKEPPTFIRELKPVEVVRDSDVELECEVKGTPLFEVTWLKNNKEIRSS
KKYTLTGRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCNARVSLKEPPSFTKKIENVT
TVLKSAATFQSTVAGSPPISMTWLKDDQILDEDDNVRISFVNNVATLQIRAVDNGHSGRY
TCQAKNESGVERCYAFLLVQEPAQILEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDG
KQIVPSRYFTMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLNVLDQNIPPS
FTKKLAKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLICHENTVALEVNN
LELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPERQQAIPESTVEFKAVLKGTAP
FKIKWFKDDVELASGPKCFIGLEGSTSFLNLYSVDASKTGQYTCQVTNDVGSDSCTTMLL
VTEPPKFVKKLEASKIVKAGDSSRLECKITGSPEIRVVWYRNEHELQASDKYRMTFIDSV
AVMQMNNLGTEDGGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNTEVSLEC
ELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHASIHILNVEASDIGDYHCKAQNEVGSD
TCICTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGIQPISVQWLKEKEEVIRESENIR
ITFVENVATLQIAKAEPANAGKYICQIKNDGGMRENMATLTVLEPAVIVEKAGPMTVTVG
ETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSVERQDAGTYTFQV
QNNVGKSSCTAVVDVSDRMVPPSFTRKLKDTCGVLGTSCILECKVAGSSPISVAWFHEKT
KIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKE
PEPLEVLPGKNVTFTSVIRGTPPFKVGWFRGARELVKGDRCNIYFEDTVAELELFNVDLS
QSGEYTCVVSNGAGQTSCTTRLFVKEPAAFVKRLSDHSVEPGKPIILESTYTGTLPISVT
WKRDGVNITTSEKCSIVTTEKTCILEILNSTKRDAGEYSCEIENEAGRDVCKALVSTLEP
PYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVF
NKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRL
NGSAPIQVSWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASS
STRLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYT
ITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLGVKEPPKFVKKLEASKVAKQ
GESIQLECKISGSPEIKVLWFRNDSELHESWKYSMSFISSVALLTINEASTEDSGDYICE
AHNGVGDASCSTALTVKAPPVFTQKPSAVGALKGSDVILQCEISGTPPFEVVWVKDRRQV
RSSKKFKMTSKNFDASLHILNLEASDVGEYHCKATNEVGSDTCVCTVKFREPPRFVKKLS
DTSTLVGDAVELQAVVEGFQPISVVWLKDKGEVIRESENIRISFVDNIATLQLSSPEASN
AGKYVCQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVAGSPELSAKW
FKDGRELSADSKHHITFIKKVASLKIPCAEMSDKGLYSFEVRNSVGKSNCTVSVHISDRV
VPPSFIRKLKDTNATLGASVVLECRVSGSAPISVGWFQDGNEIVSGPRCQSSFSENVCTL
NLSFLEPSDAGTYTCVAANVAGSEECSAVLTVQEPPSFEQTPDSLEVLPGMSVSFTGVIR
GTPPFKVKWFKGSRELVSGESCTISLEDSVTELELFEVEPLQSGDYSCLVTNDAGSASCT
THLFVKEPATFVKRLADFSVQTGSPIVLEATYTGTPPISVSWMKNEFPLSQSPNCSVTMT
EKSTILEILNSTVEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHMEAAIGEPTT
LQCKVDGTPEIIISWYKEHTKLRSAPAYKMQFKNNVASLIINKVDHSDVGEYTCKAENSV
GAVASSAVLVIKERKLPPTFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKD
DSNLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKP
ISVDLALGESGSFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGD
AGQYTCYASNAAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDENTRYECKIGGSPEIRVL
WYKDETEIQESSKFRMSFLDSVAVLEMHHLSVEDSGDYTCEARNAAGSASSSTSLKVKEP
PIFRKKPHSIETLKGTDVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENFLTSIHI
LNVDTADIGEYQCKATNDVGSDTCVGSITLKAPPRFVKKLSDLSTIAGAEVQLQTTIEGA
EPISVVWFKDKGEIVRESDNIWISYSENTATLQFSRAEIANAGKYTCQIKNDAGMQECFA
TLSVLEPAAIVEKPESIKVTTGDTCTLECIVTGTPELSTKWFKDGKELTSDSKYKISFFN
KVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTVSVQVSDRTIPPSFTRKLKETNGLSGSS
VVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDAGDYTCVATN
VAGSDECSAPLTVREPPSFVQKPDAMDVLTGANVTFTSIIKGTPPFSVSWFKGSSELVPG
DRCNVSLEESVAELELFDVDTSQSGEYTCIVTNEAGKASCTTHLYVKAPAKFVKRLNDYS
LEKGKPLILEGTYTGTPPISVTWKKNGINITPSQRCNITTTEKSSILEIPSTTVEDSGQY
NCYIENASGKDSCSAQIQILEPPYFVKQLEPVKVTVGDSASLQCQLAGTPEITVSWYKGD
TKLRPTATSKMHFRNNVATLVFNQVGSHDSGEYICRAENSVGEVSSSTFLTVQEQKLPPS
FSRQLRDVQETVGLPVVFECAISGSEPLSVSWYKDGKPLKDGPNVQTSFLDNVATLNIFK
TDRGLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRVAPVDAVVGESADFECHITG
TQPIKVSWAKDSREIRSGGNYQISYLENTAHLTILKVDRGDSGQYSCHAVNEVGKDSCAA
QLNIKERLIPPSFTKKLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNVEIHPTSNCDI
TFKNNILLLQVKKASMGDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLSPVTVI
EGEFVQLSCHVQGSEPIRIQWLKAGKEIKSSDRCSFSFASGTAMLELKDVAKADAGDYVC
KASNAAGSDTSKSKVTIKDKPAAMPAAKKAAVDGKLFFVSEPQSIRVVEKTTATFIAKVG
GDPIPNVKWTKGKWRQLNQGGRVSIHQKGDEVKLEIRDTTKTDSGLYRCVAFNKHGEIES
NVNLQVDERKKQEKIEGDLRAMLKKAPTLKRGSGEEEEIDIMELLKNVDPKEYEKYARMY
GITDFRGLLQAFELLKQSQEEETHRLEIEELEKSEKEEKEFEELVSFIQQRLSQTEPVTL
IKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTVKLEPSDKFEISIDGDRHTLRVKN
CQLKDQGNYRLVCGPHIASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWF
RNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTK
RIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPD
DEGVYSVIARLEPRGEARSTAELYLTTKEIKLEMKPPDIPDSRVPIPTMPIRAVPPEEIP
PTAVPPIPLLLPSPEEKKPPAKRIEVTKKAVKKDTKKVVTKPKEAPPPKVPEVKRPPSPT
ALIPAKAPEVIDVSSKAEEVKITTITRKKEVQKEKEAVFEKKQAVYEEKKVYIEPLEEPY
DELEVEPYTEPFEEPYYEEPEEDYEETRGEAKKEVHEEWEEDFEEGQEYYERTEGYDEGE
EEWEETYREQEVIQIQKEVYEELHERKIPEKVPEKKKAPPPKVAKKPVVEKIEKTSRRIE
EERVQVTKVPEVSKKIVPQKPSRTPVQEEVVEVKVPAVHTKKMVISEEKMFFASHTEEEV
SVTVPEVQKKTITEEKIHVAVSKEIEPPPKVPEPPKKTVPEVVPVPTPKKVEPPPAKVPE
VPKKPVPEEKKPVPVPKKEPAAPPKVPGVPKKPVPEEKIPVPAAKKMEAPPAEVPEVQKR
VVTEEKITVVTQREESPPPAVPEIPKKKVPEGKRPTPPQKVEEAPPPKVPAPPKKPVPEE
QVSLPAPVAKKAPPPRAEVSKKTVLEEKRLVAEEKLSIAVPQRVEVTRHEVSAEEEWSYS
EQEERVSFSVYREEREEEEEAEVTEYEVLEEPEEYVVEEKLHFISKRVEAEPAEVPEKRE
KKIVPKPKIPAKIEEPPQAKVPEAPKKTELEKKIPAAVPRKEKVPPAKVPEEPKKPIPEK
MAPPKVAKIEEPPPTKVTQRHMQITQEEKVLVAVTKKEEPPRARVPEEPKRAVPEEKVLK
LKPKKEEAPPAKVTEFRKRAVKEETISIEVPKREPRPTKEVTVTEEKEWSYTREEESVSV
QREEYEEYEEYDREEFVEYEPIEEYEQYEDYAERELYKETKEQEEYITEPERPIPVKPVQ
EEPVPTKPKAPPTKVLKKAVPEEKVAVPIPKKLKPLPPKVPEESKKVVEEKVRISITKRE
KEQVTEPAAKVPMKPKRVITEEKVLIAKKEVAAPVKESLFFLLLQMAVFLTLLNFVEKLE
NVQPKDNIFKVPEVPKRREPEEIAFEEEVVTQVEEYLEEEEYVHEEEEYLHEEEYLHEEE
YLHEEEEVIAEEVVPVIPVKVPEIPKKPVPEEKKPIPVPKKKEAPPAKVPEIPKKPEEKV
PVPIPKKEKAPPAKVPEVPKKPVPEEKVPAPVPKKVEAPPAEVPEVPKKPVPEKKVPVPV
PKKVEAPPIKVPEVPKKLIPEEKKPTPIQKKMEAPPPKVPKTREPVPVPVALPREEEVPF
EEEISPEEEVLPEEEEILPEEEEVPPEEEEEEVPPEEEEFVPEEVLPEIKPTVPVPARVP
EVKKKVPEKKVIVPKKEEAPPATVPEVPKKVEEIIPPTEEEVPPVEVYEEPEEPIPEEEI
PEEPPSIEEVEEVVPPRVPKVVKKAVPEAPTPVPKKVEAPPAKVPKKVPEEKVPVPVQKK
EAPPAKVPEVQKKVPEKKVPEKKIPEKRVPVPKKEAVPPAKGMTVFEEKISVAFHKEEVV
RERMELEVVEAQVEEAHEGEFHEVEEYFEEEEFHEVEEFIKVEKHRFEEVHKVEETRRVI
GFLEAEEVDVYEKPKAPPKGPEISEKVIPPKKPPTKVVPRKEPPAKVPEAPKKIVEEKVH
VPEEPKFPPAKEVVPEKKAPVVPPKKPEVPPVTVPEAPKEVVPEKKVPLAPPKKPEVPPA
KVPEVPKAAVPEKKVPEAIPPKPESPPPEVPEAPKEVVPEKKVSVAPPKKPEAVPVKVPE
APKEVVPEKKVPLAPPKKPEVPPAKVPEVPKAAVPEKKVPEAIPPKSESPPPEVHEEPEE
IVSEEPPAEVVEEPEPVAPPKVTMPPKKPVPEKKPPAVAAKKPEPPPMKVPKVPKEVVPE
KKVPPVVLKKPQVPPAKVPEVPKEVVPEKRVTVPKMPEVPPAKVPEVPEKPVVEEKPAVP
VPKKVESPPPEVYEEPEEIAPEEEVPVPVVEEEEPKAPPPAVPEEPKKIVPEKKVPIIKK
PEAPPAKEPEPEPEKKVIEKPKFKPKPPAPAPAPPKEDVKEKAFQLKAVSKKVPEKPEVP
EKVELKPVKVPGVEKKVRKLLPEPKPQPKEEVVLKSVLRKRSEEEEPKVEPKKVEKVKKP
TVPEPPPKAVEEVEAPPAKKEEKKIPEPAKVPEIKPAIPLPGPEAKPKPEPEVKTVKPPP
VEPAPTPIAAPVTAPVVGKKAEAKPKEEAAKPKGPIKGVAKKTPSPVEAERKKLRPGSGG
EKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECLVSPSTAITSWMKDGSS
IRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLIVEELPVRFVKT
LEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGKIVPGVIGLMKALTINDADDF
DAGTYTVTVENANNLECSSCVKVVEIIRDWLVKPIRDQHVKPKGTAVFTCHIARDTPNIK
WFKGYDEIPWEPTDKTEIVKEGNYVHLKIKNAVPEDIDEYAVEIEGKRYPAKLTLGEREV
ELLKPIEDVTIFEKESASFDAEISEEDVPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHK
VKLDQAGEVLYQAFNAVTTAILTVKEIELDFAVPLKDVTVPEKRQARFECVLTREANVIW
SKGPDIIKSSDKFDIIVDGKKHILVINDSQFDDEGVYTAEVAGKKTSAQLFVTGVRLNFI
SPLEDQTVKEGQTATFVCELSHEKMHVVWYKNDAKLHTSRTVLISSEGKIHKLEMREVTL
DDISQIRAQVKDLKSTANLKVLEADPYFTVKLHDKTGVEKDEIILKCEVSKDVPVKWFKD
GEEIVPSTKHSMKSDGLRRILKIKKAEFSDKGEYVCDCGTDKTKANVNVEARLIKVEKPL
YGVELFVGETARFEIELSEPDVHGQWKLKGEPLTASPDCEIIEDGKKHILVLYNCQLDMT
GEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQ
EITGDDKVELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSAKLIIEGIRLKFLTPLKD
VTAKERESAVFTVELSHDNIPVKWFKNDQRLHTSKVVSMHDEGKTHSITFKDLSLDDTSQ
IKVEAMGISSEAKLTVLEGDPYFTGKLQDYTAVEKDEVILQCEISKADAPVKWFKDGKEI
KPSKNVVIKADGKKRMLILKKALKSDIGEYTCDCGTDKTSGKLDIEDREIKLLRPLYSVE
VMETETARFETEISEDDIHASWKLKGEALLQTPDCEIKEEGKVHFLILHNCRLDQAGGVD
FQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEP
SDKVVTRSEGRVHTLTLRDVKLEDAGEVQLTAKDFKTQANLFVKEPPVEFTKPLEDQTVE
EEATAILECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCD
AKDFKTSCNLNVVPPHVEFLRPLTDLQVKEKEMARFECEISQENAKVQWFKDGAEIKKGK
KYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAIFTKNLANIEVSET
DTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTDGRKRVLVIQNAQLEDTGSYNCRLP
SSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFEVQWKRDDMTLESGDKY
DIIADGKKRILVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLKIIVPLKDTRVKEQQEV
IFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDARLDDQANYNVSLTNNR
GENVKSAANLIVEEEDLRIVEPLRDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVAFDN
RIIYRVDKYKHSLIIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEF
DDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVE
DRKSRARLFVEEIPVEIIRPPQDILEAPGADVIFLAELNKDKVEVQWLRNNMIVVQGDKH
QMMSEGKIHRLQICDIRPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGQPL
TMVVPYDAYPKAEAEWFKENEALSSKTVDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGK
AEAFINLQVIDVPGPVRNLEVTETFDGEVGLAWEEPLTDGGSKIIGYVVERRDIKRKTWV
LATDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNV
TITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVE
GQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLNSSDQTQSSVQLTWEPPLK
DGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLQKGKKYLYRVSAENEAGVSDP
SEILGPLTADDAFVEPTMDLSAFKDGLEIIVPNPIKILVPSTGYPRPTATWSLGDQILEE
GDRVKMKTLSAYAELVISPSERPDKGIYTLKLENPVKAISGEIDVNVIARPSAPKELKFG
DITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVIDFVTDLEFTVPDLVQGKEY
LFKVCARNKCGPGEPAYIDEPVNMSAPATVPDPPENVKWRDRTAKSIFLQWDPPKYDGGS
RIKGYLVEKCPRGSDRWVACGEPVAETKMEVTGLEEGQWYSYRVKALNRLGASKPSKPTD
EIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADKLLKQDKRI
TIENVPNKSTVTIIDSKRSDTGTYIIEAVNACGRATAVVEVNVLDKPGPPAAFDITEVTN
ESCLLTWNPPRDDGGSKVTNYVVERKATDSDMWHKLSSTVKDTNFKATKLTPNKEYLFRV
AAENMYGVGEPVQAAPITAKFQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGY
WVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILI
KDPIDPPWPPGKPTVKDVGKTSLVLNWTKPEHDGGAKIESYVIEMLKTGTDDWVRVAEGV
PTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITK
NTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGALYVFRV
AAENAIGQSDYCEIEDSVLAKDTFTTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQR
YIIEKKEKLGTRWVKAGKTSGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILS
IEDPTSPPSPPLDLHVTDAGRNHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSR
PIKDLKFKVEEGVVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDCKPTIDLETHDIV
VIEGERLNIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKSDHISANLEVPKSVHADAGVY
TITVENKLGSATASINVKVIGLPGPCKDIKASDVTKSSCKLTWEPPEYDGGSPILHYVLE
RREAGRRTYIPVMSGENKLTWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPK
QPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEDRWKRCNEHLVPIL
TYTAKGLEEGKEYQFRVRAENAAGIGEPSRATPPTKAVDPIDAPKIIMRTSLEVRRGDEI
ALDATISGSPYPTITWLKDENVITPEEIKKRVAPTVRRKKGEAQEEEPFVLPLAERLSID
NSKKGESQLRVRDSLRPDHGQYMIKAENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKNS
VLCKWEPPLDDGGSEIINYILEKKEKTKPDSDWIIITSTLRHCKYSVTKLIEGKEYLFRV
RAENRFGPGPPCVSKPLTAKDPFEPPDAPDKPTVEDVTSSSMLVKWNEPKDNGSPILGYW
LEKREVNSSHWSRVNRSLLNALKTNVEGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAH
DPISPPGPPVPRVADTSSTTIELEWEPPTFNGGGEIIGYFVDKQLVGTNEWSRCTEKMVK
VRKYTVKEIREGADYKLRVSAVNAAGEGPPGETEPVTVAEPQEPPTVELDVSVKAGIQIM
AGKTLRIPAVVTGRPEPTRVWTVEEGELDKDRVVIENVGTKSELIIKEALRKDRGRYVIT
ATNSCGSKFAAARVEVFDVPGPVLDLKPVVINRKMCLLNWSDPADDGGSEITGFIIERKE
AKMHTWRQPIETERSKCDITGLFEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTA
PERLTYTERTKSTITLDWKEPRSDGGSPVQGYIIEKRRHDKPDFERVNKRLCPTTSFLVE
NLDERQMYEFRVKAVNAVGESEPSLPLNVVIQDDEVPPNIKLRLSVRGDTIKVKAGEPVN
IPADVTGLPMPKIEWSKNDTVIEKPTDALKITKEEVSRSEAKTELSIPKAVREDKGTYTI
TASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKR
DASRKKSEWEEVTNTAVERRYGIWKLIPNGQYEFRVRAVNKYGISDDCKSDKVVIQDPYR
LPGPPGKPKVLDRTKGSMLVSWTPPSDNGGSPITGYWLEKREEGSAYWSRVSRAPITKVG
LKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPSEPSDPAVAGDPIYPPGPPSCPEVKDKT
KSSISLAWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLLTTCECVVPNLKELRKY
RFRVKAVNEAGESEPSDTTGEIPATDIQEAPEVYIDIGAQDCLVCQAGSQIRIPAVIKGR
PTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHSGKYSITAKNKA
GQKTASCRVKVMDVPGPPKDLKVTDITRGSCRLTWKMPDDDGGDRIKGYVIEKKTIDGKA
WTKVNPNCGSTTFLVPDLISEQQYFFRVRAENRFGIGAPVETVQRTTARDPIYPPDPPIK
LKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGKKKEAWKQCNRRDVEELEFT
VEDLVEGGEYEFRVKAVNAAGVSKPSATVGPVIVKDQTCPPSIDLKEFMEVEEGTDVSIV
AKIKGVPFPTLTWFKAPPKKPDNKEPVIYDTHINKLVVDDTCTLVIPQSRRSDTALYTIT
AVNNLGTASKEMRLNVLGRPGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKR
EPNRKTWVRVSSEPKECTFTVPKLLEGHDYVFRIMAQNKYGIGEPLDSEPETARNLFSVP
GAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLG
VSYKMTGLIEGSDYQFRVYAINAAGVGPASPPSDPVTARDPIAPPGPPFPQVTDWTKSSA
DLEWTPPLKDGGSKVTGYIVEYKEEGKEEWEKAKDKEVRGTKLVVTGLKEGAFYRFRVRA
VNIAGIGEPGEVTDAIEMKDRIVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVT
WSMNERALPQEATIEDTAISSSMVIKNCQRSHQGVYSLLAKNAGGERKKTIIVDVLDVPG
PVGTPFLADNLTNDSCKLTWFSPEDDGGSPITNYVIQKREADRRAWTPVTYTVTRQNATV
QGLIQGKAYFFRIAAENSIGIGPFVETPNEIVIRDPITVPERPEDLEVKEVTKNSVSLTW
NPPKYDGGSEIINYVLESRLIGTEKFHKVTQDNLLSRKYTVKGLKEGDTYEYRVSAVNIV
GQGKPSFCTKPITCKDELAPPTLDLDFRDKITIRVGEAFALTGHYSGKPKPKVTWFKDEA
DVVEDDRTHIKTTPTTLALEKIKAKRSDTGKYSVVVENSTGSRKGFCQVNVVDRPGPPVG
PVTFDEVTKEYMVISWKPPLDDGGSEITNYIIEKNEVGKDIWMPVTSASAKPTCKVSKLL
EGKDYIFRIRAENLYGISDPLVSDSMKAKDRFRVPDAPEQPIVTEITKDSALVTWNKPND
GGKPITNYILEKRETMSKRWARVTKEPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDP
SPPSKPFFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRRDGGSKILGYIVEYQKVGDE
EWRRANHTPESCPETTYKVTGLREGQTYKFRVLAVNEAGESDPAHVPEPVLVKDRLEPPE
LILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKGDREAPTKARIDVTPVGSKLEIR
NAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDG
GSVVTNYVVERRDVASAQWSPLSTTSKKKSHWAKHLNEGNQYLFRVAAENQYGRGPFVET
PKPIKAVDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWI
KFKTVTELECVVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLI
EGLVVKAGTTVRFPAIIRGVPFPTAKWTTDGSEINTDEHYTVETDNFSSVLTIKNCLRRD
TGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPIDILDITPEHMTISWLPPKDDGGSPVI
NYIVEKKDTRKDTWGVVSAGSSKTKLKVPHLQKGCEYVFRVRAENKMGVGPPLDSTPTVA
KHKFNPPSPPGKPVVTDITENAATLSWTLPKSDGGSPITGYYVERREITGKWVRVNKTPI
ADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSPSSDPIKACRPIKPPGPPINPKLKDKTK
ETADLVWTKPLSDGGSPILGYVVECQKAGTTQWNRINKDELIRQCAFTVPGLIEGTEYRF
RIKAANVVGEGEPRELPESVMAKDILHPPEVELDVTCRDVITVRVGQTIHILARVKGRPQ
PDITWTKEGKVLVREKRVDMIHDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVN
VLDRPGPCQNLRVSNVNKENCTISWENPLDNGGSEITNFIVESRKPNQKGWSIVASDVTK
RLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFV
YLKWRRPDYDGGSPNLSYHVERRLKGSADWERVHKGSIKETHFMVDKCVENQIYEFRVQT
KNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGETIRLEAGVRGKPFPEVSWTK
DKDATDLTRSPRVKIDTSADSSKFSLTKAKRSDGGKYVITATNTAGSFVAYATVNVLDKP
GPVRNLKISDVNSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSSAVLTPGATV
TRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKFDRPGRPDPPDVTKVSKEEMTVVWS
PPEYDGGKSITGYFLEKKEKHSIRWVPVNKSAIPERRLKVQNLFPGHEYQFRVKAENEIG
IGEPSLPSRPVVAKDPIEPPGPPTNLKVVDTTKNSITLGWGKPVYDGGAPILGYVVEMRP
KKEDASPDEGWKRCNAPAQLVRMEFTATSLDENQEYEFRVCAQNQVGIGRPAELKDAIKP
KEILEPPEIDLDASMRKLVTVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLV
DTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHI
SWAPPENDGGSQVTHYIVEKREAERKTWSTVTPEVKKTSFQVTNLVAGNEYFFRVTAVNE
YGPGVPTEVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISY
REEEQPADHWTEYSVVKDLSLVVTGLKEGKKYKFRVVARNAVGVSLPREAEGVYEAKEQL
LPPKILMPEQITIKAGKKLRVEAHVYGKPHPTSKWKKGEDEVVTSSHLAVHKADSSSILI
IKDVTRKDSGYYSLTAENSSGSDTQKIKVIVMDAPGPPQPPFDITDIDADACSLSWHIPL
EDGGSSITNYIVEKCDVSRGDWVTALASVTKTSCRIGKLIPGQEYIFRVRAENRFGISEP
LTSPKMLAKFPFDVPSEPKNARITKVNKDCMFVAWDRPDSDGGSPITGYLIERKERNSLL
WVKANDTPVRSTEYPCVGLIEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPE
VVDISKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTTPHQIPQEEYTATGLE
ENAQYQFRAIAKTAVNISQPSEPSDPVTILAENVPPRIELGVNMKSLLTVKAGTNVCLDA
TVFGKPMPTVSWKKEDTLLKPAEGIKMARKRNLCTLELFSVTRKDSGDYTITAENSSGSK
SATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQ
VSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPILTEPAIAKNPYNPPGRCDPPVIS
NITKDHMTVSWKAPADDGGSPITGYLVEKRETQAVNWTKVNRKPVIERTIKATGLQEGTE
YEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGG
SPIIGYLVEVKRADSANWVRCNLPDKLQKTRFEVTGLMENVEYQFRVYAVNKVGYSDPSD
VPDNHCPKDILIPPEGELDADLRKTIILRAGVTLRLYVPVKGRPPPKITWSKPDANLRER
IGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKE
ISKDSAYITWDPPIIDGGSPIINYVVEKRDAERKSWSTVATECPKTSFRVSNLEEGKSYF
FRVFAENEYGIGDPGETRDAVKASETPGPVVDLKVRSVTKSSCTIGWKKPRSDGGSRIIG
YVVDFLTEDNKWQRVMKSLNLQYSAKDLIEGKEYTFRVSAENENGEGTPSEIMAVAKDDV
VAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPTPSVSWKKGEDPLATDTRVSVESSAVN
TTLVVRDCQKSDAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIRFDEVTAEAITLKW
GPPKDDGGSEITNYILEKRDSVNNKWMTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYG
VGEGLKSEPIVAKHPFDVPDAPPPPNIVDVRHDSVSLTWTDPRKTGGSPITGYHIEFKER
NSLLWKRANKTPIRMKDFRVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP
GKPEVISVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAFTVTD
LVEGGKYEFRIRAKNTAGAISAPSESTGTIICKDEYEAPTIVLDPTIKDGLTVKAGDTIV
LSAISILGKPLPKSNWSREGKDIRLSDVVQITSTPTSSMLAVKYATRKDAGEYTITATNP
FGTKEEHVKVTVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKSYVLEKRETSRL
LWTTVAEDIQSCRHVATKLIQGNEYLFRVSAVNQYGKGEPVQSEPVKMVDRFGPPGPPEK
PEVSNVTKNTATVSWKRPIDDGGSEITGYHVERREKKGLRWVRATKTPVSDLRCKVTGLQ
EGNTYEFRVSAENRAGIGPPSDASNLVLMKDVAYPPGPPSNARVTDTTKKSASLAWGKPH
YDGGLEITGYVVEHQKVGEEAWIKDTTGTALRITEFVVPDLQTKEKYNFRISAINDAGVG
EPALVPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDDINL
KNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPT
DITKDSVTLHWDLPLVDGGSRITNYIVEKREATRKSYTTATTKCHKCTYKVTGLTEGCEY
FFRVMAENEYGIGEPTETTEPVKASEAPLPPESLNIMDITKSTVSLAWPKPKHDGGSKIT
GYVIEAQRKGSDQWTHITTVKGLECVVKNLTEGEEYTFQVMAVNSAGRSAPRESRPVVVK
EQTMLPELDLRGIYQKLVIARAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNIENT
ATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFIT
FSWDPPENDGGVPISNYVVEMRQTDSTTWVELASTVIRTTYKATRLTTGVEYQFRVKAQN
RYGVGPGITSASIVANYPFKVPGPPGTPQVTAVTKDSMTISWNEPLSDGGSPILGYHIER
KERNGILWQNVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPI
DPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFT
VSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDIEAPRIMVDIKFKDTIILKAGE
TFKLEADVSGRPPPTMEWTKNGKELEGKGKLEIKIADFSTTLVNKDSSRRDGGAYTLTAT
NPGGFAKHIFNVKVLDRPGPPEGPLAISEVTSEKCVLSWLPPLDDGGAKIDHYVVQKRET
SRLAWTNVAAEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVDPYGPPDP
PKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKTVTDLRFKVS
GLTEGHEYEFRIMAENAAGISAPSAASPFYKACDAVFKPGPPGNPRVLDSSRSSISIAWN
KPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITNLIENQEYKIRIYAMNSE
GIGEPALVPGTPKAEDRLLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPVPEVKWSRE
HGESLDKASIESTSSYTLLIIGNVSRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQD
LKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQE
GCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLVDVTRNSVSLSWEKPEHDGG
SRILGYIVEMQSKGSDKWVTCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSV
PVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWLKDEVPLKQTTRVNAE
STENNSLLTIKEACREDVGHYTVKLTNSAGEATEILSVIVLDKPGPPTGPVKIEEVTADS
ITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAA
ENRYGKSTYLNSEPIVAQYPFKVPGPPGTPYVTLSSKDSMEVRWNEPVSDGGSKVIGYHL
ERKERNSILWVKLNKTPIPQTKFKTTGLEEGIEYEFRVSAENIVGIGKPSKVSECYVARD
PCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNVIDTQ
FEVTGLVEDNRYEFRVIARNAAGVLSEPSESTGAITARDEVDPPRISMDPKYKETIVVHA
GEFFKIDADIHGKPIPTTQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK
AKNVAGERSVTVNVKVLDKPGPPEGPVIITGVTAEKCTLAWKPPLQDGGSDIINYIVERR
ETSRLVWTVVDANVQTLSCKVTKLLEGNEYMFRIMAVNKYGVGEPLESEPVIAKNPFVVP
DAPKAPEITTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLR
VTGLIENHSYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVTDITRSSVFLS
WSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNLEVEKLLEKHEYNFRICAIN
KAGVGEHADVPGPVIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWG
KMDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPP
VNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQL
QEGCSYYFRVTAENEYGIGLPARTADPIKVAEVPQPPGKITVNDVTRNSVSLSWTKPEHD
GGSKIIQYIVEMQAKQSEKWSECARVKSLEAVITNLTQGEEYLFRVVAVNEKGRSDPRSL
AVPIVAKDLVIEPDVRPAFNNYSVQVGQDLKIEVPISGRPKPTITWTKDGVPLKQTTRIN
VTDSLDLTILSIKEAHKDDGGHYEITVANIVGQKTASIEIITLDKPDPPKGPVKFDEVSA
ESITLSWNPPLYTGGCQITNYIVHKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRI
FAENRYGQSFALESDPIVAQYPYKEPGPPGTPFVTAISKDSMVVQWHEPINNGGSPVIGY
HLERKERNSILWTKVNKTIIHDTQFKAVNLEEGIEYEFRVYAENIVGVGKASKNSECYVA
RDPCDPPGTPEAIIVKRNEITLQWTKPAYDGGSMITGYIVEKRDLPEGRWMKASFTNVIE
TQFTVSGLTEDQRYEFRVIAKNAAGTISKPSDSTGPITAKDEVELPRISMDPKFRDTIVV
NAGETFRLEADVHGKPLPTIEWLRGDKEVEESARCEIKNTDFKALLVIKDAIRIDGGQYI
LRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCTLTWSPPLQDGGSDISHYVVE
KRETSRLAWTVVASQVVTNSLKVTKLLEGNEYIFRIMAVNKYGVGEPLESAPVLMKNPFV
LPGPPKSVEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLR
LRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHTVDTTKNSIT
VAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPPTGLKVTRFEISKLIEHQEYKIRVCA
LNKVGLGEATSVPGTEKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEIT
WSREEGEFTDKVQIEKGVNYTHLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPG
PPQNLAVKEVKKDSVILVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSNKCSKTSFKVE
NLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPE
HDGGSRILGYVVEMQSKGTEKWSVVAESKVCNAVVTGLSSGQEYQFQVKAFNEKGKSDPR
VLGVPVIAKDLTIQPSLKLPFNTYTVQAGEDLKIEIPVIGRPKPKISWIKDGEPLKQTTR
VNIEETATSTILHIKESNKDDFGKYTVTATNSAGEATENLSIIILEKPGPPVGPVRFDEV
SADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWQIVSATVARTTIKISKLKTGSEYQF
RIFAENRYGKSTPLDSKPVIVQYPFKVPGPPGTPFVTSISKDQMLVQWHEPVNDGGSKVI
GYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECF
VARDPCDPPGRPEAIVITRNSVTLTWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNV
LETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSESSGAITARDEIDAPNASLDPKYRDVI
VVHAGETFVLEADIRGKPIPDVVWLKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGG
QYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVSGVTAEKCYLAWNPPLQDGGANISHY
IIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESEPVIACN
PYKPPGPPSPPEVSAITKDSMVVTWARPEDDGGAEIEGYILEKRDKEGIRWIKCNKKTLT
DLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRS
SVSLAWNKPIYDGGAPVKGYVIEVKEATADEWTTCTPPTGLQGRQFTVTELKENTEYNFR
ICAINSEGVGEPATIPGSVVAQDRLEPPEIELDADLRKVVILRASTTLRLFVTIKGRPEP
EVKWEKADAILTERAQIEVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLD
SPSAPVNLTVREVKKDSVTLSWEPPLIDGGAKITNYIIEKREATRKAYATVTNNCTKVTF
KIENLQEGCSYYFRVLASNEYGIGLPAETTEPIKASEPPLPPGRVTLVDVTRNTATIKWE
KPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTTGEEYVFRVAAVNEKGRS
DPRQLGVPVIARDIEIEPSVELPFNTFNVKARDQLKIDVPFKGRPQATVSWKKDGQILKE
TTRVNISSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITVIVLDKPGPPGPIRID
EVSCDNITISWNPPEYDGGCQISNYIVEKRETTSTTWHVVSQAVARTSIKIVRLTTGSEY
QFRVCAENRYGKSSYTESSAVVAEYPFSPPGPPGTPKVVHATKSTMIVSWQIPVNDGGSQ
VIGYHLEYKERSSILWSKANKILIPNTQMKVSGLDEGLMYEYRVYAVNIAGIGKCSKACE
PVPARDPCDPPGQPEVTNITRKSVSLKWSKPRYDGGAKITGYIIERRELPDGRWLKCNFT
NVQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRD
VIVVKAGEVLKINADIAGRPLPVVSWAKDGVEIEERARTEIVSTDYNTLLTVKDCVRRDT
GQYVLTLKNVAGTRSMAVNCKVLDKPGPPAGPLEINGLTSEKCSLSWGPPQEDGGASIDY
YIVEKRETSRLAWTICEGELRTTSCKITKLLKGNEYIFRVTGVNKYGVGEPLESVAVKAL
DPFTVPSPPTSLEITSVTKEFMTLCWSRPESDGGSEISGYIIERREKNGLRWVRVNKKPV
YDLRVKSTGLREGCEYEYRVFAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKVVDSGK
TNITISWVKPLFDGGAPIIGYTVEYKTSDETDWTTAIQSLRGTEYTINGLTTGAEYVFRV
RSVNKMGASDPSDSSDPQIAKEREEEPVFDLDTEMKKTLIVKAGASFTMTVPFRGRPVPS
VSWSKPDTDLRTRAYIDSTDSRTSLTIENANRNDSGKYTLTIQNHLNVASLTLVVKVLDS
PGPPANISVHDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYK
VTNLQEGAIYYFRVSGENEFGVGAPAETQEGVKITEKPSPPEKLGVTSVSKDSVSLAWLK
PEHDGGSRIVHYIVEALEKGQKNWVKCAVVKSTRHVVSSLRENSEYFFRVFAENQAGLSD
PRELLLPVLVKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPL
KATMRFNTEVTAENLTINLKESVAADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPI
VVSDITEESVTLKWEPPKYDGGSHVTNYIVLKRETSTAVWAEVSSTVARTMIKVMKLTKG
EEYQFRVKAENRFGISDHIDSACVVVKLPFTTPGPPSTPWVTNVTRESITVAWHEPVSNG
GNAVIGYHLEMKDRNSILWQKVNKMVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSH
PSEPVLAIDACEPPRNVRITDISKNSVNLSWQQPAFDGGSKITGYIVERRDLPDGRWTKA
SFTNVIETQFTVSGLTQNSQYEFRVFARNAVGSVSNPSEVVGPITCIDSYGGPVIDLPLE
YTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNALVCVENTTDLASILIKDANR
LNSGSYELKLRNAMGSASATIKVQILDKPGPPGGPIEFKTVTAEKITLLWRPPTDDGGAK
ITHYIVEKRETSRVVWSMVSENLEECIITTTKIIKGNEYIFRVRAVNKYGIGDSLESDPV
VAKNAFVTPGPPSIPEVTKVTKNSMTVVWNRPVADGGSEIIGYFLEKRDKKSLGWFKVLK
ETIRDTRQKVTGLTENSDYQYRVSAVNAAGQGPFSEPSDFYKAADPIDPPGPPAKIRISD
STKSSITLGWSKPVYDGGSAVTGYVVKMRQGEEEEWTIVSTKEEVRTTEYVVSNLKPGVN
YYFQVSAVNCAGQGEPIVMTEPVQAKDILEEPEINLDVAFRTSIIAKAGEDVQVFVPFKG
RPPPTVTWRKDEKNLGSDARYSIQSTDSSSLLMIPQVTRNDTGKYILTIENGVGEPKSST
VSVKVLDTPAACQKLQIRHVSQGTVTLFWDPPLIDGGSPIINYVIQKRDATKRTWSAVTN
KCSSTSFKVTDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSVKDSTKT
SVTLSWTKPDFDGGSVITDYVVERKSSTEQAWSHAGISKTCEIEIGQLKEQSVLEFRVSA
KNEKGLSDPVTIGPVTVKELVITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISW
MKDGLPLKESENVRLSKTENKITLNIKNAKKENGGKYAIILDNAVCRNSFPITVITLGPP
SKPKGPIRFDEIKADSVIMSWDVPEDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFK
VPNLVKDSEYQFRVRAENRYGVSQPLVSTIIVAKHQFRIPGPPGKPVVYNVTSDGMSLTW
DAPVYNGGSEVTGFHVEKKERNSILWQRVNTSPISGREYRATGLIEGLDYQFRVYAENSA
GLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGS
DRWVRCNFTDVCECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGVIMTRDENVPPT
VEFGPEYFDGLIIKAGQSLRIKALVQGRPVPRVTWFKDEVEIEKKMNMEITDVLGSTSLF
VRDATRDHRGVYRVEAKNVSGSAKAEITVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPL
NDGCAPVTHYIVEKRETSRLAWALIEDKCEAHSYTATKLITGNEYQFRVSAVNKFGVGRP
LDSDPVVAQIQYTVPDAPGTPEQSNVTGNSITVTWTRPESDGGNEIQHYILERREKKSTR
WVKVISKRPISETRFKVTGLIEGNEYEFRVMAENAAGVGPASDISRLIKCREPVSPPSAP
SVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLEDWHKVNAEACVKTRYTVTD
LQAGEEYRFRVSAINGAGKGESCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRL
FIAYQGRPAPTAVWSKPDSNLSIRADIHTTDSFSTLTVENCNRNDAGKYTLTVENSSGSK
SITFTVKVLDTPGPPGPITFKDVTRGSVTLMWDAPLLDGGARIHHYVVEKREASRRSWQV
VSEKCTRQILKVNDLAEGVPYYFRVSAENEYGVGEYYEMPEPIIATEQPAPPKRLDIVDT
SKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHTKQLTFTVESLVENTEYEFR
VKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPTP
KVTWKLEEMRLKETDRMSITTTKDRTTLSVKESMRGDSGRYFLTLENTAGVKTFTITVVV
IGRPGPVTGPIEVSSVSAESCVLSWAEPKDDGGTEITNYIVEKRESGTTAWQLINSSVKR
TQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIAEHPFVPPSAPTRPEVYHVSANAM
SIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTNLVEGLEYQFRTYA
LNAAGVSKASEASRPMMAQNPVDAPGRPEVTDVTRSTVSLIWSAPIYDGGSKVVGYIIER
KPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTC
RDEYAPPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQ
YTGKRATAVIKFCDRSDSGKYTLTVKNAGGTKAVSVLVKVLDTPGPCGNLTVSRVTEEKC
TLAWSLPPEDGGAAITHYIVERRETSRLNWVIVESECPTLSYVVTRLIKNNEYIFRVRAV
NKYGPGVPAETQPIIARNSFTIPSQPGIPERVGAGKEHIIIQWLKPESDGGNEISNYLVD
KREKKSLRWTRVNKDYVVYDTRLKVTGLMEGCDYQFRVTAVNAAGNSEPSEASNFISCRE
PSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIIGYVLEMQEKDTDQWYRAHTNATI
RNTEFTVVDLKMGQKYSFRVAAVNVMGMSEYSESVAEIEPVERIEIPDLELADDLKKTVT
IRAGASLRLMVSVSGRPPPVITWSKKGIDLVNRAIIDTTESYSLLIVDKVNRYDAGKYTI
EAENQSGKKSATVLVKVYDTPGPCPSVTVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKR
EAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLV
PTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKADTDRWMKVVTLKSTVLEHTVV
SLNEGEQYLFRVRAQNEKGVSEPREIITPVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVE
LVIPIAGRPPPAASWFFSGSKLKESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVT
GTTSETIKVIILDKPGPPTGPIKVDEIDATSVTISWEAPELDGGAPLSGYVVEQRDAHRP
GWLPVSESVTRTTFKFTRLIEGNEYVFRVAATNRFGIGSYLQSEVIECRSSISIPGPPET
LEIFDVSRDGMTLTWYPPEEDGGSQVTGYIVERKEVRAERWVRVNKVPVTMTRYRSTGLI
EGLEYEHRVTAINMRGTGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSAPE
DEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGE
PAEVPGTVKITEMLEHPDIELDEKYQEGVLVRQGGVIRLTIPIKGKPYPICKWTKEGQDI
SKRAMIATSETHTELVIKEAVRDDSGTYDLVLENKCGKKAVYIKVRVIGIPNTPEGPLEY
DDIQARSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVE
YHFRVSAENQFGISKPLKSEEPVIPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDG
GSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRVIAQNDVGLSETSP
ASEPVICKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAW
KKSNKDHIKDRQFTIGGLLEATEYEFRVFAENEAGLSRPRRTAMSVKTKLTSGEAPGVRK
EMEDVTTKLGEAAQLSCQIIGRPLPDIKWYRFGKELVQSRKYKMSSDGRTHTLTVMTEEQ
EDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPV
PAITWFRGQKLVQNSENTTIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDV
EIQDKPDKPTGPIVIEALLKNSVVISWKPPEDDGGSWITNYVVEKCEAKEGAEWQLVSSA
ISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVPSVVIIKSPFEKPSAPGKPTITAIT
KESCVVAWKPPASDGGAKIRNYYLEKREKKQNKWIAVTTEEIRETVFSVQNLIEGLEYEF
RVKCENLGGESEWSEISEPVTPISDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKP
IVKWYRQGKEIIADGLKYRVQEFKGGYHQLVIATVTDDDATVYQVRATNQGGSVSGTASL
EVEVPAKIHLPKTLEGMGAVHALRGEVISIKIPFSGKPDPVITWQKGQDLIDNNGHYQVI
VTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSEVSRDS
VNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAE
NKFGLSKPSEPSEPTVTKEDKTRAMNYDEEVDETMEVSMTKASHSSTKELYEKYMIAEDL
GRGQFGIVHRCVETSSKKTYMAKFVKVKGTDQVLVKKEISILNIARHRNILYLHESFESM
EELVMIFEFISGLDIFERINTSAFELNEREIVSYVRQVCEALEFLHSQSIGHFDIRPENI
IYQTRRSSIIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLV
YVLLSGINPFLAETNQQMIENIRNAEYTFDEEAFKEISLEAMDFVDRLLVKERKSRMTAS
EALQHPWLKQKTERVSTKVIRTLKHRRYYHTLIKKDLNMVVSAARISCGGAIRSQKGVSV
AKVKVASIEIGPISGQIMHAVSEEGGHVKYICKIENYDQSTQVTWYFGVRQLENSEKYEI
TYEDGMATMYIKDITKFDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKMK
RRTDAMRLLERPPEFTLPLFNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDDK
KYTFESDKGLYQLTINSVTTDDDAEYAIVARNKYGEDSCKAKLTVTPHPPPADTTLRPMF
KRLLANAECQEGQSVSFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRD
TLPEDTGYYRVTATNTAGSTSCQAHLKVERLRYVKQEFKSKEERERHVQKQIDKTLRMAE
ILSGKESVPLTQVAQEALREAAILYKPAVSTKTVKGEFRLETEERQQERKLRMPYEVPEP
RKHKQPATEEDQRIKQFVPMSDMKWYKKIRDQFEMPGKIDRVVQKRQKRIRLSRWEQFYV
TPLPRFTDQYRPKWRIPKLTQDDLEMVRPARRRTPSPDYAFYYRPRRRSLGDISDEELLL
PIDDYLAMKRTEEERLRLEEELELGFSASPPSRSPPRFELSSLRYSSPQAHVKVEETRKD
FRYSTYHIPTKAETSTSYAELRERHAQAAHRPPKQRQRILAAREDEELLRPLAATQRLSE
YKSELDRMSKEQKSRKKSKQQRQVTEITEIEEEYEITKRAQRESSSSVSRLLRRRRSLSP
TYIELMRPVAELIRTRPPPAEESEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARF
DIFSRYESMKAALKTQRTSERKYEVLTQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNV
QSKPTAEVKWYHNGVELQESSKIHYTNTSGVLSLEILDCHIDDSGTYRAVCTNYKGEASD
YATLDVTGGDYTTYASRRRDEDAPRSIFPDLTRTEAYAVSSFKKTSEMEAASSVREMKSQ
MTETRESLSSYEHHASAEMKRAAVEEKLLEEKSTHRKIKSTLAARILTKPRSITVSEGES
ARFSCDTDGEPVPTVTWLRGGQVISTSTRHQVTTTKYKSTFEISSVQASDEGNYSVVVEN
SEGRQEAQFTLTIQKSRVTEKAVTSPPKVKSPEPQVKSPEGVKSPKRVKSPELVTSPPKA
VSPTETKPPATEKVGQLPVPAPPKITQSLKAEAVKDIAKLTCAVESSVLCAKEVTWYKDG
KKLKENGHFQFHYSADGTYELKIHNLTESDCGEYICEISGEGGTSKTKLQFMGQAFKSIH
EQVSSIAETKKSTQKTAESTETKVSAQKSAESTEAKVSAQKTAELTETKVSAQKTELTET
KVSAQKTAESTETKISAQKTAESTETKISAQKTAESTETKIAAQKTAESTETKKTETKAP
EPISSKPVIVTGLQDTTVSSDSIAKFSIKATGEPQPTVIWTKDGKAIAQGGKYKLSEDKG
GFFLEIHKTDTSDSGLYTCTVTNSAGSVSSSCKLTIKAVKDTEMQKVSTEKTSEITSQKK
AVVQEEISQKALISEEITKSEVKSQEKLALVEEASKVTISEKVKKSEAASLEKSIVHEEV
TKTSQEISTQAEIKAFSSQMSITDGQKVTLKANIAGATDVKWVLNGAELTNSEEYRYGVS
GGEQTLTIRRAGREHEGVLTCIGKTSQGIVKCQYDLSLSQELSGAPAFISQPRSQNVNEG
QSVLFSCEISGEPSPEIEWFKNNLPISVSSNISVSRSRNAYSLEIRNASVSDSGKYTIKA
KNFRGQCSATASLTVLPLVEEPPREVVLKTSGDTSLQGSFSSQSVQMSASKQEASFSSFS
SSSASSMTEMKFASMSAQSMSSMQESFVGMSSSSFMGKSSMTQLASSTSRMLTAGVRGIP
PKIEALPSDISIDEGKVLTVACAFTGEPAPEITWSCGGREIHSEEQGRFRIENTEDLTTL
IIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSI
NT seq 100548 nt   +upstreamnt  +downstreamnt
atggcaactcaagcaccgacgtttaagcagccgttacaaagtgttgtggtactggagggt
agtgccgcaacctttgaggctcacattagtggtttgccagttcctgaggtgagctggttt
cgggatggccaggtgatttccacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctagattgacgatccccgccgtgacaaaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgacagcagaa
acagcgccacccaactttgtacaacgactgcagagcatgacagtgagacaaggaagccaa
gtgcgactccaagtgaaagtgactggaatccctacacctgtggtgaagttctatcgggat
ggagccgaaatccagagctcccttgattttcaaatttcacaagaaggcgacctctacagc
ttactgattgcagaagcataccctgaagactctgggacctattcagtaaatgccaccaat
agcgttggaagagctacttcgactgctgaattactggttcaaggtgaagaagtagtaccc
gctaaaaagacaaaaacaattatttcgactgctcagatttcagaaacaagacaaacccga
attgaaaagaagattgaagcccactttgatgccagatcaattgcaacagttgagatggtc
atagatggtgccactgggcaacagctgccacataaaacacctcccaggatacctcctaag
ccaaagtcgaggtctcccaccccaccgtccatttccgctaaagcacagttggctcgacag
caatccccatcgccgataagacactccccttccccggtcagacatgtgcgggcaccgacc
ccatctccggtcaggcctgtgtctccagctgggaggatctccacctcccccatcagatct
gtgaagtctccatcacccatacgtaaggctcagacgcccaccatgggccaaggccctgaa
gtgcctcccccttggaagcaagagggctacgtggcctcatcggagtctgagatgagagaa
accatggtgacaagtgctactcagatccggagggaagagagatgggaagggagatatggg
gtccaggagcaaatgaccatcagcggagctgcaggcgctgctgcgggcatatcagctgga
gaggtgaaacaagaaactgacaaaagtgcagctgttgcgactgttgttgctgctgttgat
atggccagagtgagagaaccaggaatcagcgctgtagagcagactgctcagaggacaacc
acgactgccgtgcacatcccacctgctcaagaacagatgagaaaggaagcagagacatct
gctgtaactaaggcagtaatggctgccgacaaagccaaggagcaagaattaaaatcaaga
accagagaagtaattacaacaaaacaagagcaggtgcacgtaactcatgaacagataaga
aaagaaactgaaaaagcctttgtaccaaaagtagtaatttccacaactaaagccaaagaa
caagaaactagaatttctggagaaattactacaaagcaagaacaaaaacaagtaactcaa
gaaacaataagacagacagctgagacaactgctgcatccatggtggtagttgccactgca
aagcccacaaaactagaaacaattctgggagctcgagaagaaattgccacaaaacaagat
caaatgcacattactcatgaaaagataatgaaagaaactagaaaaacagtggtacctaaa
gttatagttgccacacccaaagtcaaagaacaagatttagtatcaagaagtagagaaggc
atcactaccaagagagagcaagttcaaataactcaggaaaagataagaaaggaagctgag
aaaattgccttgtctacaatagcagttgctactgctaaagccaaagaacaagaaacgata
ctgagaactagagaaggaatggctactagacaagaacaaatccaagttactcatggaaag
atggatgctgagaaaaaggcagaagctgtagcaacagtggttgctgcagtagaccaggcc
cgtgtcagagagcccagagagcccgggcatgtcgaagaatcatatgctcagcagactact
ttagagtatggatataaggagcatgtttccaccacaaaggtagctgagcaaccccagcgt
ccggcctcggagccccatgttgtccctaaagcagtcaagcctagagtgatccaagctcct
tctgagactcatatcacaactactgaccaaatggaaatgcatatatcatcacagatcaag
aaaactacagatgtaacgactgaaagattagtccatgtggataaacgccctcgcacagca
agccctcattttactgtttcaaagatttctgttcccaagacagaacctggatatgaggca
tcaatagccggtagcgctattgccacgttacaaaaagagttgtcagccacatcttctcag
aagattaccaaatcggtgaaggcacccactgtgaagcctggtgagactagagtgagagca
gagcccaccccctcaccccagtttcccttcgctgacacacccgagacttacaagagtcaa
gctggcattgaagtgaaaaaggaagtaggggtgagcatcactgatggcacagtccgtgaa
gagcgcttcgaagtactccacgggcgtgaagccaaggtaacagaaaaagcaagagtacct
gcacctgctgaaatccccgttactccaccaactttggtctcgggcttaaaaaatgtgact
gtcatagaaggtgaatccgtcaccttggagtgccacatctctggatacccgtcacccaaa
gtgacatggtacagagaagactaccaaatagaaagctccattgatttccagataaccttc
cagagcggaatcgctcgtcttatgattcgagaagcctttgccgaggacagcgggcgattc
acttgcagcgctgtgaatgaggccgggactgtcagcacgtcctgctacctggctgtgcag
gtatcagaagagtttgaaaaagaaaccacagccgtgactgagaaatacaccacagaagag
aaacgcttcgtggagtcaagagacgtggtgatgactgacaccagcattgtggaggaacga
gcagagcccggagaaccctctgcgcctttcttcatttcaaagccggtggtccagaaactg
gtggaaggcgggagcgttgtgtttgaatgccaggttggcggcaacccaaagccccatgtt
tactggaagaaatccggggttcctctaaccactggatacagatataaagtgatttacaac
aaacaaaccggggaatgcaaactggtgatttcaatgactttggcggatgatgctggagaa
tatactattgttattcgtaataagcatggagaaacatcggcatctgcctccttgctcaga
gaagctgattatgactcactgatgaagtcccagcaagaaatgttttatcagacacaaatg
actgcatttgtccaagaacctaaagttggagaaatagcaccaggatttggatacgccgat
tatgagaaagagtatgaaaaagaacaggccttaattaggaagaaaatggccaaagatact
gtcctggtcagaacttttgtagaagaccaagaattccacatttcttcctttgaagagagg
cttattaaagaaattgaatacagaataataaagactacattagaagaacttcttgaagag
gatggggaggaaaagatggcagttgacatttctgaatctgaagctgttgaagcaggattt
gatttaagaatcaagaattacaggattcttgaggggatgggtgttacttttcattgcaag
atgtctggctatccattacccaagattgcatggtacaaagatggcaagcgcatcaaacat
ggagagagataccaaatggacttcctaccagatggcagagctagtctgcgaatacctgtt
gttcttccagaagacgagggaatctatactgcatttgccagcaatatgaaaggaaacgca
atctgctctgggaaattgtatgtggagcctgctgctccacttagtgctcccatgtacatt
cccacaccagagcccatgagcagaatcagatctgtctctccgcgttcagtgagcaggtct
cctatacgcatgtctcctgcacggatgtcccctgcacggatgtcccctgcacggatgtcc
cctgggcgtaggctggaggaaacagatgagtcacaactcgagagactgtataagccagtc
tttgtgttaaaacctgcttctttcaaatgtttagaagggcaaactgccagatttgactta
aaggttgtgggtagacctatgccagagaccttctggtttcataatggccagcaagttatc
aacgattatacccataaagtagtcattaaagaagatggtacccaatctctgattattgtg
ccaacagcacccagtgattctggggaatggactgtgattgcccaaaacagggcaggcaaa
tcttcaatttcagtgactttaactgtggaagccgtggaacatcaggttaaaccagtgttt
gtggaaaaactgaaaaatgtcaatgtaaaggaaggttcccggcttgaaatgaaagtcaga
gcgacgggtaaccctaaccctgacattgtatggttgaaaaacagtgaaatcattgtacct
cataaatatccaaaaatcagaattgaaggaaccaagggagaagctgcccttaaaatagat
tccactgtcagccaagattctgcctggtatactgcaactgctattaacaaggctggccga
gacactaccagatgcaaagtaaatgttgaagttgagtttgcagaacctgaaccagagaga
agattaatcatcccacgagggacatatagagcaaaggaaattgcagccccagagctggag
cctttgcatttgcgatatggtcaagaacagtgggaggagggtgacctgtacgacaaagag
aaacaacagaaaccattttttaagaaaaaactcacttccttaaggctcaagcgctttggg
cctgcccactttgaatgtaggctaacaccaattggtgacccaacgatggtggtggaatgg
ctccatgatggaaagccacttgaagcagccaacaggcttcgtatgatcaatgaatttgga
tattgcagccttgattacggagttgcgtattctagagacagtggcattattacttgcaga
gccactaacaaatacggaacagatcacacatctgctacccttattgtaaaagatgagaaa
agtcttgtggaagaaactcagttgcctgagggcaggaaaggcttacagagaattgaagaa
ttagagaggatggctcatgaaggtgcacttacaggtgtaacgacagatcaaaaggagaag
caaaagccagacatcgtcttgttcccagagccagtaagggtacttgaaggggagacagca
agattccgttgccgagtgacaggttaccctcatcccaaagtcaactggtacctcaatgga
cagctcatccgcaaaagtaaaaggttcagagttcgctatgatggcattcattatctggac
atcgtggactgcaaatcttatgatacaggtgaagtcaaagtcaccgcagaaaatcctgaa
ggtgtcacagagcataaagtgaaacttgagatccaacagagggaagattttaggtctgtc
cttaggcgagcccctgaaccaaagcctgagtttcatatacatgagcctggaaagcttcag
tttgaggtacaaaaagtagataggcctgttgacaccaccgaagccaaggaaattgtgaag
ttgaaaagggctgagagaattacccatgaaaaggttcctgaagaatcagaagagctgcgc
agtaaattcaagcgcagaacagaggaaggatattacgaagccattactgctgtggagctc
aaatctcgtaaaaaggatgagtcctatgaagagctccttaagaagacaaaagatgaactt
ctccactggaccaaagagctaactgaagaggagaagaaagcccttgttgaagaaggcaaa
atcactattccaacttttaaacctgatagaattgaactaagtcctagtatggaggccccc
aaaatctttgaaagaatccaaagccaaacagtgggccagggatctgatgcacacttccgg
gtcagagtcgtggggaaaccagatcctgaatgtgaatggtacaaaaacggtgtcaagatc
gaacgctctgaccgagtctactggtactggcccgaagacaatgtttgtgaactggtcata
agagatgtgaccactgaagactctgccagcatcatggtaaaagccatcaatatagctggg
gaaacctcaagccacgcattcttacttgtccaagccaagcaattgatcactttcatccag
gaattacaagacgttgttgctaaggaaaaagacaccatggcaacctttgaatgtgaaact
tcagagccatttgtcaaagtgaaatggtataaagatggtgtggagattcattcgggagat
aaatataggatgcactctgacaggaaggttcatttcctttccgttctgaccattgacaca
gctgatgctgaagactacagctgtgtgcttgtggaagatgaaaatgtgaaaacaactgcc
agacttactgttgaaggtgcagttattgaatttgtaaaagaacttgaggacatagaagtt
ccagaatcattctcaggagagttagagtgcattatatccccagaaaatatagaaggcaaa
tggtatcacaatgatgtggagcttaaatctaatggcaaatactcaattacatctcgccgt
ggacggcagaaccttactgtcaaggatgtggccaaagaggaccagggagaatacagcttt
gttgttgacgggaaaaagaccacctgtaaactaaagatgaaaccccgtcccattgctatc
ctacaaggacttagtgatcaaaaagtctgtgaaggtgacattgttcagctcgaagttaaa
gtctccttagaaaacgtggaaggcatctggatgaaagatggccaagaagtgcagcccagt
gacagggttcacgttgtgatagacaaacagtcacacatgctgctcattgaagacatgacc
aaggaggatgctggaaattactccttcaccattccagcccttgaaatgtcaaccagtggg
cgcgtctctgtctatagtgttgatgtgataacacctctaaaggatgttaacgtgcttgag
ggtaccaaggctgttctcgaatgtaaggtctctgtccctgatgtgacttctgttaaatgg
tatttaaatgatgaacaaatcaagcccgatgatcgcgtacaagccattgtcaaaggcact
aagcagcgactagtgattaaccggacccatgcttcagatgaaggaccttacacgctgatg
gttggcagagttgaaaccagctgcaatctctctgtagaaaaaattaaaattataagaggt
cttaatgaccttaccagtacagaaacccaaaatgtggtccttgaagttgagctgtcccac
tcaggaattgatgtcttgtggaaatttaaagacaaggaaatcaaacccagttctaaatat
aaaattgaagctcatggaaaaatatataagttgacagttcaaaatatgatgaaagatgat
gaaggagaatatacattttatgctggagaaaatatgacatctggaaaacttactgtggca
ggcggggccatctccaagccactcacagaccagactgttgccgagtctcaggaagcagtg
tttgaatgtgaagttgccaaccctgattccgaaggcgagtggctgaaggatggcaaacat
ctgccactaagtaacaacatcagaagtgaatctgatggccacaaacggaggcttatcatt
gcttccaccaaattagatgacattggagaatatacctacaaagtggccacctctaaaaca
tcggctaatctcaaagttgaagctgtcaaagttaagaagacgctgaagaacctcacagtg
acagagacgcaagacgctgttttcacgattgagctaacacaccctaatgtgaaaggtatc
cagtggatcaaaaatggggttgtgctggaatccaacgacaagtatgatatctcagtcaaa
ggaacagtttactctctgagaattaaaaactgtgccatggtggatgagtctgtttatggc
ttcaagcttggaaagctgggagccagtgccagactgcacgttgagactgtcaagatcatt
aaaaagccaaaggatgtgactgccttggaaaatgccaccgttgcctttgaagttagtgtt
tcccatgacacggttccggtgaaatggttccacaagaatgtggagattaagccgagtgac
aaacacagactagtctcagaaaggaaggtccacaagctgatgctacagcacattgccccc
tcggacgctggggaatatacagctgtggtgggacagctggaatgcaaagctaagctcttt
gtggagacattacatattacaaaaaccatgaagagcattgaggtgcctgagaccagaacg
gcctcctttgaatgcgaggtatcccacttcaacgtccccgccatgtggctgaagaatggt
gtggagattgagatgagtgagaagttcaagatagtggtgcagggaaaactccaccagctg
atgatcatgaacaccagcacagaggactcggcagaatacacatttgtctgtggcaatgac
caagtcagtgccaccttgaaagtgaccccaatcatgatcacatccatgctgaaggacatc
aatgctgaagaaaaagacacaattacctttgaggtgacagtgaaccatgaaggcatctcc
tacaaatggttaaagaatggtgtggaaatcaaatcaacggacaggtgccagatgagaacc
aaaaagctcacccactccctgaatatcaggaatgtccactttggggatgctgctgattac
acctttgtggctggaaaagctacgtcgacagccaccctttatgtggaagctcgtcatata
gaatttcggaaacacattaaggacattaaggttctcgagaagaagcgagccatgtttgaa
tgtgaagtctctgagcctgacatcactgtacagtggatgaaagatggccaagaactgcag
attgtggacagaatacagatacagaaggagaaatacgtccaccgccttctgataccatcc
acccggatgtccgacgctgggcagtacacagtggtggcaggaggcaacatgtccacagcc
aatctctttgtagagggcagggatgttcgcatccgaagtattaaaaaggaggtccaggtt
attgagaaacaacgtgcagtcattgagtttgaggtcaatgaagacgatgttgatgcccac
tggtataaagatggcattgaaatcaatttccaaattcaagaacgacatgagtatgttgta
gagcgaagaatccaccggatgtttatctctgagaccaggcacagcgatgccggtgaatac
accttcgtggcaggaaggaacaggagttctgttaccctctatgtcaatgctccagaacca
ccccaagttctgcaggagctccagcccattactgtgcaatctggcaagcctgcccgcttc
tgtgctgtgatctccggcagaccacagcccaaaatttcctggtacaaggaagagcagctg
ctttccactggcttcaagtgcaagtttctccacgatgggcaagagtacacgcttttgcta
attgaagccttcccggaggacgcagctgtctacacctgtgaagccaagaatgactatgga
gttgccacaacctcagcttcgctctcagtggaagttccggaggttgtgtctcctgaccag
gaaatgccagcttaccctcctgccatcgtcaccccacttcaggatactgtcacttctgag
ggacagccagctcgtttccagtgcagggtttcgggaacagatctaacagtgtcttggtac
agcaaggacaagaaaattaagccatctcggttctttagaatgactcagtttgaagacact
taccaactggaaattgctgaagcttatccagaagatgaagggacttatacttttgttgct
aataatgccgtaggtcaagtgtcaagcacagccaatttgagactggaagcctatgaatca
attttacacgagaggattgaacagcagattgaggtggagatgaaagccgccccggtgatc
aagaggagaatcgagccccttgaagtagctctgggccacctcgccaagttcacctgtgag
atccaaagtgcccccaatgtccgattccagtggtttaaagctggccgagaaatttatgag
agtgacaagtgttccatccgatcttcaaattatgtctccagcctggaaatcctcagaacc
caggttgttgactgcggcgagtacacctgcaaagcgtccaatgagtatggcagtgtcagc
tgtacagccacactcactgtgacagaggcatatccaccaacctttttctccagacctaag
tccgttacaacttttgtgggtaagacagccaagttcctctgcacagtgacagggactcct
gtgattgaaaccatttggcagaaagatggtgctgctctgtcaccttcccctaaccgcaag
atttcagatgcagaaaacaaacacagtttagaactctcaaatcttacaattcaagataga
ggagtttactcttgtatggcttctaacaagtttggagctgacatctgccaagctgagttg
atcataattgacaaaccacatatcattaaagaattagagcctgtgcaatcagctatcaat
aagaagatccaccttgaatgccaagtagatgaagacagaaaagtcacagtgacatggaat
aaagatgggcaaaaactcccagctggcaaagattataagatctattttgaagataaaata
gcatcccttgagatccctcttgccaaactaaaagattcaggaacctatgtctgcacagct
tcaaacgaggctggaagcagctcttcttcagcaacagtaactatcagagagccaccatcc
tttgtgaagaaggtggatccctcctatttaatgctcccgggtgaatcagcgcgcctccac
tgcaagctgaaaggctcacctgggatccaggttacttggtttaaaaataacaaagaactt
aatgagagtagcacagtccgaatgtcttttgcccattccgaggccatacttgatattacc
gatgtaaaagtggaagacagcgggacttactcctgcgaagcagtgaatgacgtgggcagt
gatagctgcagtgctgaaatagtgatcaaagaacctccttctttcgtcaaaactctagag
ccggcagatatagtgagaggaacaaatgccctccttcagtgtgaaatctcaggcacggga
ccgttcgagattagctggttcaaagataagaagcagattcgaagtagtaaaaaatacagg
ttgttctctcagaagtctcttgtgtctctggagatcttttcttttaatagcgcggacgtt
ggtgaatatgaatgtgtggtcgctaatgaagtcgggaagtgtggctgcagtgccacacac
ttactgaaagaaccaccaacctttgtaaagaaagtagatgattttactgcactagcagga
caaactgttaccttacaagctgctgtgagagggtcagaacccatttctgtcacatggatg
aaaggacaagagatcattaaagaagatggaaaaatcaaaatgagcttttccaaaggggtc
gcggtcttgataatccccgatgttcagattaatctggggggcaagtacacatgcctggct
gagaatgaggcagggagccaaacgtctgccggggaattaatagttaaagaacctgccaaa
attgttgagcgagcagaactgatccaggtgacagcaggagacccagccacgctggaatac
acagtcacaggcaccccagaactcaagcccaaatggtacaaagacgggagacctttggtt
gccagtaaaaagtatcggataagttttaaaaacagtgttgcccaactcaaattttactca
gctgagctgcaggatagtggccaatacacctttgaaatttccaacgaagtgggcagcagc
tcctgcgagacaactttcactgtcctagatcgagacattgctccattttttaccaaaccc
ctacgcaacatggatagtgtcgttagcgggacctgcaggctggactgcaaaatcgcgggc
tccctcccaatgagggtgtcctggtttaaggacagtaaagaaatagctgcttccgacaga
tacagaatagcatttgtggaaggcacagcctctttggagataagcagagtagacatgaat
gacgcagggaacttcacctgtcgagccacaaactccgtgggaagcaaggacagcagcgga
gccctgatcgtgcaagaaccacccagttttgtaactaaacccgcatccaaagatgttctg
cccggctcggcagtctgcctgaagagcacctttcaagggtccgttcctctcacaatcaga
tggtttaagggtgacacagagctggtttccggtggaagctgctatatcaccaaagaagct
ttagaaagttccctggaactctattcagtaaaaacctccgattcaggcacatatacctgt
aaagtcagcaacgtcgccggaggcgtggagtgcagtgcaaacttgtttgtaaaagaacct
gccacatttgttgaaaagttagagccatcacagctcttaaagaaaggagatgccacccag
ctagtctgcaaagtcactggtactcctccaattaaaataaggtggtttgtaaacgataga
gaaattaaggagagcagcaaacacaaaatgtcttttgtggagtccactgcggttctaaaa
cttacagatgttgccgtcgaagacagtggtgaatacatgtgtgaggctcagaacgaggct
ggcagtgaccactgtggtagcattttaatagtcaaagagtcaccttactttacaaaagaa
tttaagccagttgaagtgttgaaggagtatgacgtcatgttgctggccgaggttgcaggc
acgcctccctttgagatcacttggttcaaagacaacacgacgctgcgaagtggtaggaag
tataaaacctttattcaggatcggctggttagcctgcagatcctcaagtttgcagctgcc
gatgctggcgaataccagtgtcgggcaagcaacgatgtgggcagcgggacctgcagtgcc
agggtgacgctcagagaaccaccaaccttcgtaaagaagatcgagagcaccagctccctt
cgaggaggcacggctgccttccaggccactctgaaaggctccttgccaatcacagtgact
tggttaaaagacaacgatgaaatcactgaagacgataatataagaatgacctttgagaac
aatgtggccagtctgtatctcagcggcatcgaagtcaagcatgatgggaaatatgtctgt
caggccaaaaatgatgcaggaatacaaagatgttctgcattgctctcagtaaaagaacct
gcaacaatcaccgaggaggctgtgtctatagatgtcacccaaggagacccagccactttg
caggttaaattttcagggactaaggagattacagccaaatggtataaagatggccaagaa
ctcaccctgggccaaaaatataaaatcagtgttaccgacacagtgtccatactgaagatt
atttctacagaaaagagagatagtggagaatatacttttgaggtccaaaatgatgttggg
agaagcagctgcaaggctagcattaatgtgttagatcttatcatacctccctcattcacc
aaaaagctgaagaaaatggacagcattaaagggtcttttattgacttagaatgtatagtg
tctgggtcacatcccataagtatccagtggttcaaagatgaccaggaaatttcagctagt
gaaaaatacaaattctcttttcatgacaataccgccttcttggaaatcaggcatctggaa
agtatagacaccgggacatacacttgttctgccactaacaaggcaggacacaaccagtgc
agtggccatctgatggtcaaagaacccccttacttcgtggaagagccacaatcgcaagat
gtcaatcccagtgcgcgggttcagttaaaggctcttgtgggtggcactgcacccatgaca
attaagtggtttaaagataataaagagttgcactccggagcagctcgctcagtttggaag
gatgacacctccactgtgctagagctcttttcagcgaaagctgctcattctggaacctac
atttgtcaactaagcaacaatgttggcatagcaaccagcaaagccactctctttgtaaaa
gaacctcctcaattcgtcaagaagcccagcccagttttggtgctgaggaatggacagtct
acaacatttgaatgccaaataacaggcactcctgaaatcagagtttcctggtatctggat
gggaatgaaataacagccatagagaaacatggcatctccttcatcaatggtttagccact
ttccagatttccagtgccagggtagaaaatagtgggacttacgtctgtgaagctcgtaat
gacgcaggcacagcaagctgcagcatcgaattaaaagtgaaagaacctcccacctttatc
agggagttgaagcccgtggaagtagtgagagatagtgacgtggagctggagtgtgaagtt
aaggggacacctctgtttgaagtcacttggctgaagaataacaaggaaattcgaagcagc
aaaaagtataccctgactggcagagtgtctgtgtttaatctccatataaccaagtgtgac
ccgtcagacactggggaataccagtgcatcgtgtccaatgaaggcggcagctgctcttgc
aatgctagagtctccctcaaagaaccaccatcgttcacgaagaagatagaaaacgtcact
actgttttgaaaagtgctgccacctttcagagtaccgtggcaggctcccctcccatttcc
atgacctggctgaaggatgatcagattcttgatgaagacgataatgttcgtatttccttt
gtgaacaatgtggccacacttcagatcagagctgtggacaatgggcacagtgggagatac
acgtgtcaggccaagaatgagtccggagttgagaggtgttacgctttccttttggtacaa
gaaccggctcaaatcctagagaaagctaaatctgttgatgttactgagaaagacccagtg
actttggagtgtgttgtggctggaacgccagaactcaaagtgaaatggcttaaagatggg
aaacaaattgtgcccagtagatattttacgatgagttttgaaaataacgtggccagtttt
agaattcagtcagtaatgaagcaagacagtggtcagtacactttcaaggtggaaaatgac
tttggaagcagtagctgtgatgcctacctgaacgtgctagatcaaaatattcctccatca
ttcaccaaaaaattagccaaaatggataaagttctgggctcttctattcatatggagtgc
aaggtttctggctcacttcctattagtgctcaatggtttaaggatggaaaagaaatatct
acaagtgccaaatacagactcatctgtcatgagaacacagtggccctggaagttaataat
ctggaactagaagacactgcaaattatacatgcaaggtctcaaatgtagcaggggatgac
gcctgcagtggcattttaactgtgaaagaaccaccaagcttcctagtgaaacctgagcgc
cagcaagccatacctgagtctacagtggaatttaaagcagtgctaaaaggaacagcacca
ttcaaaataaagtggtttaaggatgatgtggagcttgcctctggccctaaatgtttcatt
ggcttggaagggtcaactagcttcttaaatctctactccgtggatgcttccaagacagga
caatatacttgccaagttaccaatgatgttggtagcgactcttgcactacaatgttgctt
gtgacagaaccaccaaagtttgtaaagaaattagaagcatccaaaatagtgaaagcaggt
gactcctcacgacttgaatgcaagataactggatccccagaaatcagagttgtgtggtat
agaaatgaacatgaactccaagccagtgataaatacaggatgactttcattgactcagtg
gccgtcatgcagatgaacaatcttggtactgaggatggtggggatttcatttgtgaggct
cagaatcccgctggcagcacaagctgcagtaccaaggttatagtaaaagaaccacctgtt
tttagcagcttccctcctatagtagaaacccttaaaaatactgaagttagtcttgagtgt
gaactctcgggaacacccccatttgaggtggtgtggtacaaagacaagcggcaactccga
agcagcaagaaatacaagattgcatccaaaaacttccacgcaagtattcacattctcaat
gtcgaagcttcagacattggtgactaccactgcaaagcacagaacgaagtgggaagtgat
acttgcatttgtactgtaaagttaaaagaaccaccaagatttgtttccaaactaaacagc
ctcaccgttgtggctggggagcccgctgaattacaagcatccatagaaggcatccagcct
atttctgtccagtggcttaaagagaaggaagaagtgattagagaaagtgaaaacatcagg
atcacatttgtggaaaatgttgccactctacagattgcaaaggcagaaccagctaatgct
gggaagtatatctgccaaatcaagaatgacggtggaatgagggagaacatggccaccttg
actgtcctagagcctgcagtcattgttgagaaggcaggaccaatgacagtgactgtagga
gaaacatgcactctggagtgcaaggtggctggcactcctgaactctcagttgaatggtac
aaggatggaaagctgttgaccagcagccaaaagcacaaatttagcttctacaacaaaatc
tcttccttaaagatcctctccgttgaaaggcaagatgcaggcacatacactttccaggtt
caaaataatgttggaaaaagcagctgcacagctgtggttgatgtctcagaccgaatggtt
cctccctctttcacacgaaagctgaaagatacctgtggggtgctgggtacttcttgcatc
ttggaatgcaaagtagctggatcatcgcctatctctgttgcctggtttcatgagaaaact
aagattgtcagtggagcaaagtaccaaaccacattttcagataatgtctgtacattgcag
ctgaattctctggactcatcagatatgggcaattatacgtgtgtggctgctaatgtcgct
gggtctgatgaatgtcgtgcagtgttgactgtacaagaaccaccctcttttgtgaaggaa
cctgaacctttggaagtactgccaggcaaaaatgtcaccttcacaagtgttatcagagga
acacctccattcaaggttggctggttcagaggtgccagagagctggtgaaaggagacagg
tgcaacatctattttgaagacactgtagcagaactggaattatttaatgtcgacttatct
cagagtggagagtatacctgtgtggtatctaacggtgctggtcaaacatcctgcaccact
cgtctttttgtgaaagaaccagctgcatttgtgaagagattaagcgatcactctgtagaa
ccaggaaagcccatcattctggagagcacctacactggaacacttcctatttcagttacc
tggaaaagggacggtgttaacataaccacatctgaaaaatgcagcatagtcacaacagag
aaaacttgcatcctggaaattctgaatagcacaaaaagagatgcaggagagtattcctgc
gagattgaaaacgaggcaggaagggatgtttgcaaagctctggtgtctacattagaacca
ccttattttgttacggaactagaacctctggaggcatcagttggagattcggtttcttta
cagtgtcaagttgctgggacaccagaaattacagtgtcttggtacaaaggagacaccaag
ttacggccaacccctgaatataggacttactttacaaacaatgtggccacacttgttttt
aataaagtgaatatcaatgacagtggcgagtacacatgtaaggcagaaaatagcatagga
actgcttcttctaagactgtcttcagaattcaagagcgtcaactcccaccttcctttgca
agacaattaaaggacattgaacaaactgttgggttaccagttacactcacttgtcgatta
aatggctctgcgcccatccaagtgagctggtatagagatggggttcttttgcgagatgat
gaaaatctacagacatcctttgtagataatgtggcaactttgaaaattttgcagactgac
ttaagtcactctgggcagtactcttgctcagcttccaatccacttggaacagcatcttct
agcactagactgacagcaagagaacctaagaaatctcccttctttgacatcaagcctgta
tctatagatgttattgctggggaaagtgctgattttgagtgtcatgttactggcgctcaa
ccaatgcgaatcacttggtcaaaagataacaaggagatccgtcctggaggaaactacacc
atcacatgtgtgggaaacactccccatttgagaattcttaaagtaggcaaaggagattct
ggtcagtacacttgccaagcaaccaacgatgttggcaaagatatgtgctcagctcaactc
ggtgtaaaagaacctccaaagtttgttaagaaattagaagcttcaaaggttgcaaagcag
ggagaatccatccaactggaatgtaaaataagtggttccccagaaatcaaagtcttgtgg
ttccgaaatgacagtgagcttcacgaaagctggaaatatagcatgtcattcatcagttct
gtggcgttgcttaccatcaatgaagccagcaccgaggacagtggagactatatctgtgaa
gctcataatggtgttggggacgccagctgcagcacggcactgactgttaaagcacctcct
gttttcacccagaaaccttctgctgtaggagcccttaaaggttctgatgtcatcttacaa
tgtgaaatttcgggaacccccccatttgaagtggtatgggttaaagaccgaaggcaagtt
cgaagcagcaagaaatttaaaatgacttcgaaaaattttgatgcgagtctccatatcctt
aaccttgaagcctctgatgtaggagaatatcactgcaaagctacaaatgaggtgggaagt
gacacgtgtgtctgcactgtcaagttcagagaacctccacgatttgtgaaaaagctaagt
gacacctcaacccttgttggggatgctgtcgagttacaggctgtagtggaaggcttccag
ccaatttctgttgtctggctgaaagataaaggcgaagtcatcagagagagtgaaaacata
aggatttccttcgttgataacatcgcaaccctccaactcagtagcccagaagcatcgaac
gccgggaaatatgtgtgccaaatcaaaaatgatgctggaatgagagaatgttctgcagtc
ttgactgtactagaaccagccagaatcatagagaagccagaacccatgaccgtcactact
ggaaatccttttgcattagagtgtgtagtggctggctcaccagaactttcagccaagtgg
tttaaagatggaagggagttatctgcagacagcaaacatcacattacgttcatcaaaaaa
gtggcttcacttaagatcccctgtgcagaaatgagtgacaaagggttatatagctttgaa
gtgagaaacagtgttggcaaaagtaactgtactgtgtctgttcacatttccgatcgagtc
gtgcctccttccttcatccgcaagctgaaagacacgaacgccaccctgggggcctccgtg
gttctggagtgccgagtctctggctcggctccaatctcagttggctggtttcaggatgga
aacgagatcgttagtgggcctagatgccagtccagcttttcggaaaatgtctgtactttg
aatctcagctttctggagccttcggatgcaggcacatacacgtgcgtggctgccaacgtg
gctggttctgaggagtgctcagcagtcctgactgtgcaagaaccaccatcttttgaacaa
acccctgattctctggaagttttacctggaatgagcgtctcgttcaccggtgtcattaga
ggcacccctcctttcaaggtcaaatggtttaaaggcagcagggagctggtgtcaggggag
tcatgcaccatctctctggaagattctgtgacagaactggagttgtttgaggtggagcca
ctgcagagtggagactattcttgccttgttactaatgatgctggcagtgcctcctgtacc
acacatctttttgtgaaagaaccagccacctttgtgaaaagattggctgatttcagtgtc
cagacaggaagccccatagttctcgaggccacatatactggcacgcctcccatctcagtg
agctggatgaagaatgagttccctctttcacagtctccaaattgcagtgtcactatgaca
gaaaaatctactatcctggaaattcttaacagcacggtagaggattatgcacaatacagt
tgcctgatagaaaatgaggctggtcaagatatttgtgaagctctggtgtctgtcttagaa
ccaccttattttattgaacctctggaacacatggaagcagccattggagaacctacaact
ttacagtgtaaagtggatggaaccccagaaattataatttcttggtataaagaacacaca
aagctacgatcagctcccgcatacaaaatgcaattcaaaaataacgttgcctccttaata
atcaacaaggtggaccatagtgatgtgggagaatatacatgcaaggcagagaacagtgtg
ggggcagtcgcttcttcagctgtgcttgttatcaaagagcgcaaacttccacctactttt
gcaagaaaactgaaggatgtccatgagactcttggcttcccagttgcatttgaatgtcgc
atcaatggctcagaacctcttcaagtgtcttggtacaaagatggggtacttttgaaagat
gattctaacttgcaaacatcttttgttcataatgtagcaactcttcagattttgcaaact
gaccagagccacatcggtcagtacaattgctcagcctctaatcctcttggaactgcttca
tccagtgccaagctcatcctctcagagcatgaagtgcctcctttctttgatctaaagcct
atatcagtagatcttgctcttggagaaagtggttcttttaaatgtcatgtaactggaact
gcaccaatcaaaatcacttgggccaaagataaccgagagattcgccctggaggcaactac
aagatgactttggttgaaaatactgccactctgacagtcctcaaagtaggcaaaggcgat
gctgggcagtatacctgctacgcgagcaacgcagctggaaaagactcttgttctgctcaa
ttgggtgtacaagaaccacccaggttcattaaaaagctagaaccttcaagaattgtaaag
caggatgaaaacacaagatatgaatgtaaaataggagggtctccagaaatcagagtattg
tggtacaaagatgaaactgaaattcaagagagcagtaaattcagaatgtcattccttgac
tcggtggcagtgttggaaatgcaccatctcagtgttgaagacagcggtgactacacatgt
gaggcccgcaatgcagcgggcagtgcaagcagcagcacatccttaaaagttaaagaacca
cccattttccgcaaaaagcctcattcgattgagacactgaaaggaactgatgttcatctt
gaatgtgagcttcagggtactcccccatttcaagtttcttggcacaaagacaagagagaa
cttaggagtggcaagaagtacaagataatgtctgagaacttccttacgagcattcacatc
ctgaatgtcgacactgcagacattggagaatatcagtgcaaagccacgaatgatgtgggc
agtgacacttgtgtcggttctatcactctgaaagcaccaccaaggtttgtgaagaagctc
agtgacctgtctaccattgctggtgcagaagttcagctacagactaccattgaaggcgct
gagcccatttcggtggtgtggttcaaagataagggggaaattgttagagaaagtgacaac
atatggatttcttattcagaaaatactgcaaccctacagttttcaagagcagaaatagcc
aatgctgggaagtacacctgccagatcaaaaatgatgctggaatgcaagagtgcttcgcc
acactgtccgttcttgaacctgcagcaattgtggaaaagccagaatccataaaagttacc
acaggagacacctgtacattggagtgcattgtcactggcacacctgaactcagcactaag
tggtttaaggatggaaaagaactgacgagtgacagcaaatacaaaataagcttctttaac
aaagtatctggccttaagattatcaacgtggcacccagtgacagtggggtatacagtttt
gaggtgcaaaaccctgttggcaaagacagctgcacagtttcagttcaagtttcagaccga
accattcctccttcattcacaagaaaattgaaagaaacaaatggtctgtccggttcctcc
gttgtaatggagtgcaaagtctatggatcacctccaatctctgtctcctggttccatgag
ggaaatgagatcagcagtgggaggaaataccagaccaccctgacagataacacttgtgct
ttaactgtgaacatgctggaggaatcagatgccggcgactacacctgtgtagctactaat
gtggctggttctgacgagtgcagtgctcctttgactgtgagagaaccaccatcttttgtt
cagaaacctgatgccatggatgttttaactggagccaatgtgactttcacaagcatcata
aagggaacacctcctttcagtgtcagctggttcaagggcagcagtgaactagtaccaggg
gacagatgcaatgtgtctttggaagagtcagttgccgaactggagctgtttgatgtagac
acttcacaaagtggagaatacacctgcatagtcaccaatgaagctgggaaagcttcttgt
acaacacatctctatgtcaaagccccggctaaatttgtgaagagactcaatgattacagc
cttgagaaagggaaacccctgatcctagagggcacatacactggaactcctcccatttca
gttacatggaagaaaaatggcataaatataactccttctcagaggtgtaatataaccaca
actgaaaaatcctcaatcctggaaattccaagtaccacagtggaagactcagggcagtac
aactgctacattgaaaatgcttctggaaaagattcctgttcagcacaaatacagatccta
gaaccaccatattttgtcaagcagttggagcctgtcaaggtgactgttggagattctgcc
tctttacaatgccaacttgcagggacccctgaaattacagtgtcctggtacaaaggagat
acaaagttgagacccactgccacctccaagatgcatttcaggaacaatgttgctacactg
gttttcaaccaggttggcagtcatgacagcggagaatatatctgcagagctgagaacagt
gtgggagaagtttcttcgtcaacgttccttactgttcaagagcaaaaacttccaccgtca
ttttctcggcaattgagagatgttcaagaaacggttgggctgccggttgtttttgaatgt
gccataagtggatcagagcctctctcagtgtcttggtataaagatggcaagcctttgaaa
gatggcccaaatgtacaaacatcatttttagacaacgtagccactctcaatatttttaaa
acagatcggggccttgcaggccagtattcttgcacagctacaaatcctattgggtctgca
tcgtctagcgccagactcatcctcacagaggggaagaacccacccttctttgacatccgt
gttgcccctgtggatgccgtggtgggagaaagtgcggactttgagtgccacattactggg
acacaaccgataaaggtcagctgggccaaagacagccgagagataagaagtggtggcaac
taccagattagttacctggaaaacactgcccacctgacaattctgaaagtagacagggga
gactcaggacagtactcctgccatgctgtgaatgaagtgggaaaggactcctgcgcagct
caacttaacataaaagagcggttaatccctccaagtttcactaaaaagctctcagagaca
gtagaagaaacagaagggaattctttcaaacttgagggccgtgttgctggttcccagcct
atcactgttgcttggtacaagaataacgtagagatacatccaacttctaactgtgacatc
acgttcaagaacaacatactgctgctgcaagtcaagaaggcgagcatgggcgatgctggt
ttgtacacttgcaaagtgtcaaatgatgcaggctccgctctctgtacatcttcaattgtc
atcaaagaacctaagaagccacctgtgtttgatcagcatcttagtccagtaacagtgatt
gaaggagaattcgtgcagctcagctgccacgtccagggttcagaaccaatcaggatccag
tggttgaaggctggcaaggaaatcaagtcttcagacagatgcagcttcagctttgctagt
gggaccgctatgctggaactcaaggatgtggctaaagcagatgcgggagattatgtgtgt
aaagcctcaaacgcggctggaagtgacacctccaaatcaaaagtgaccattaaagacaaa
ccagctgccatgccagcagctaagaaagcagcggtagacgggaaactcttcttcgtatca
gaacctcagagcatcagagtggtagaaaaaaccacagcaacattcattgcaaaagttggt
ggtgatccaatccctaatgttaagtggacaaaagggaaatggaggcaactgaaccaagga
ggtcgtgtctctatccaccagaaaggcgatgaagtaaagctggagatcagagacaccaca
aaaaccgattcagggttataccgatgtgtcgcttttaataaacacggcgaaattgaaagc
aatgttaacctacaggtggacgagaggaagaagcaagagaaaattgaaggagatcttcga
gcaatgctgaaaaaggctccaaccttaaaaagaggctctggggaagaagaagaaattgat
atcatggaacttctcaaaaatgttgatcctaaagaatatgaaaaatatgcgcgcatgtac
ggaatcactgacttccgcggccttcttcaagcttttgaactgctaaagcaaagtcaagaa
gaagagacacatagattggaaattgaggaactagagaagtcagagaaagaagaaaaggaa
tttgaagaacttgtgtcatttattcagcagaggctgtcacagacagagcctgtcactctg
ataaaggatattgaaaatcagacagttttgaaagataatgatgctgtgtttgaaattgac
attaagattaattatccagaaatcaagctttcatggtacaaagggactgtcaaactggaa
cccagtgataaatttgaaataagcatcgatggtgatcgacatacactcagagtcaaaaac
tgtcaacttaaggatcagggaaattatagattggtgtgtggcccacacattgctagtgct
aaactaactgtaattgagcctgcttgggaacggcatctgcaggatgttactttgaaggaa
ggccagacttgcaccatgacatgtcagttttctgtgccaaatgtaaaatctgaatggttc
agaaatggcagaattcttaaaccccaaggtagacataaaacagaagtggaacacaaagtc
cataaactgactattgccgatgtgcgagcagaagatcaggggcaatacacctgcaaatac
gaagaccttgaaacttcagccgagctcaggattgaagctgaaccaattcagtttacaaag
cgcatacagaacatcgtggtgagcgagcatcagtctgccaccttcgagtgcgaagtgtct
tttgatgatgccattgtaacatggtataaaggaccaacagaactgactgagagccaaaaa
tacaacttcaggaatgacggtcgctgccactacatgaccatccacaacgtgacccccgat
gacgaaggtgtctactcagtcattgctcgactggagccaagaggagaggcaagaagcaca
gcagagctgtacttaacaacgaaagaaatcaaacttgagatgaagcctcctgatattcct
gactccagagttccaatccctaccatgcctatcagagctgtaccaccagaagaaatccct
cctacagctgttcctcctatccctctgttgctaccatcacctgaagaaaagaaaccacca
gcaaaacgtattgaagtgaccaaaaaagctgtgaagaaagataccaaaaaagttgtcaca
aagcccaaagaggcaccaccacctaaagtcccagaggttaagaggcctccatctcctact
gccttaattccagcaaaagctcctgaagttattgatgtatcctccaaggctgaagaagtg
aaaataacgaccatcaccagaaagaaagaggttcagaaggaaaaagaggctgtgtttgag
aaaaagcaagcagtctacgaggagaagaaagtttacatcgaacctttggaagaaccttat
gatgagctggaagtggaaccatacacagagccattcgaagaaccttattacgaagaacca
gaggaagactatgaggagaccaggggagaggcgaaaaaggaggtgcacgaggaatgggaa
gaagattttgaagaagggcaggaatactatgaaaggacagaaggttatgacgaaggggag
gaagagtgggaggagacttacagagagcaagaggttattcaaattcaaaaggaggtttat
gaagagttacatgagagaaaaattccagaaaaggtgcccgaaaagaaaaaagcaccacct
cctaaagttgcaaagaagccagtagttgaaaaaattgaaaagacttctcgaagaatagag
gaagaaagagttcaagtcacaaaagtacccgaagtttccaagaagattgttccacaaaaa
ccttctcggactccagtgcaggaagaagttgttgaagtgaaagtgccagctgtgcacaca
aagaagatggtcatttcagaagaaaagatgttctttgcatctcacacagaggaggaggtg
tcagtaacagtccctgaagtacaaaagaaaactattaccgaagagaaaattcatgttgct
gtttccaaagagattgaacctccgccaaaagtccctgagccacctaagaaaacagtccca
gaagtggttcctgttcccactcctaaaaaggtggagcccccaccagccaaagttcctgaa
gtgcccaagaaaccggtgccggaggagaaaaagcctgttcctgtacccaagaaggagcct
gccgctcccccaaaagtcccaggggtgccaaagaaacctgtccctgaagaaaagattcct
gttcctgctgcaaagaaaatggaagctccaccagctgaagttcccgaagtacagaagagg
gttgtcacagaagaaaaaataaccgttgttactcaaagagaggaatctccaccaccagca
gtgccagaaatacccaagaagaaagttcctgaaggaaaaagacctaccccgcctcagaaa
gtggaagaagctccaccaccaaaagtgccagctccgcccaagaaacctgtcccagaggag
caagtttccctgcccgctcctgtcgctaagaaagctcctcctccccgagctgaagtttct
aagaaaactgtcctagaagagaagagattggtagccgaagaaaaactatccattgcagtt
cctcaaagagtggaagtcacgcggcacgaagtatcggcagaggaggaatggagctattca
gaacaagaggaaagagtgtccttttcagtttatagagaagagagagaggaagaggaggaa
gccgaggtcacagaatatgaagtgctggaagagcctgaggaatatgttgtagaagaaaag
ctgcactttatttccaagagggtggaagctgaaccggccgaagtgcctgaaaagcgtgag
aagaaaattgtacccaaaccaaaaattcctgctaaaatagaggaacctccacaagctaaa
gttccggaagcacctaagaaaactgagctagaaaagaaaattcccgcagcagttcctaga
aaggaaaaggtgccaccagctaaagtgccagaagagccaaagaaaccaattcctgaaaaa
atggctcctccaaaagtggctaagatagaagagcctccccccaccaaagtgactcagagg
cacatgcaaattactcaggaagaaaaagttcttgttgctgtaactaaaaaagaggagcct
ccaagagccagagtgcccgaggaacccaagagagctgttccagaggaaaaagttctcaaa
ctcaaacctaaaaaagaggaggcaccaccggcaaaagtgactgaattcaggaaaagagcc
gttaaagaagaaacgatatccattgaagttccaaaaagagaacctcgtcccactaaagaa
gtaactgtaacagaagagaaagaatggtcttacacccgggaagaagaaagtgtttcagta
cagcgggaggagtatgaagaatatgaagaatatgatcgtgaagaatttgtggagtatgag
cccatagaggaatatgagcagtatgaagattatgcggaacgtgagctttacaaagagact
aaagaacaggaagaatatatcacagaacctgagaggcctatcccagtaaagccagtccaa
gaagaaccggtgcccacaaaaccaaaggccccacccactaaagttctgaagaaagctgtc
cctgaagaaaaagtagcagtgcccattcctaagaaactcaaacctctaccacccaaagta
cctgaagaatcaaagaaagttgttgaggaaaaagtacgcatttcaattaccaaacgtgaa
aaagagcaggtgactgaaccagctgctaaagtgcccatgaagcccaagagggttatcaca
gaagaaaaagtgctcattgctaaaaaagaagtagcagcacctgttaaagaaagcctgttc
tttcttctgttacaaatggctgtgttcttaacattacttaattttgttgagaaactggaa
aatgtccaacctaaagataatatctttaaagtgccagaagtacctaaaagacgagaacca
gaagagattgcctttgaagaggaagttgtaacccaagtagaggaataccttgaagaagaa
gaatatgtccatgaagaagaggagtaccttcatgaagaggagtaccttcatgaagaggag
taccttcatgaagaggaggaagtcatagctgaagaagtggtaccagtaattccagtcaaa
gtgcctgagatacccaagaaacctgttccagaagagaagaaacctattcctgttcccaaa
aagaaggaagccccaccagcaaaagtgcctgagattcctaagaagccagaggagaaagtt
cctgtgcccattcctaaaaaagagaaggctccaccagctaaagttcctgaagtacccaag
aaacctgtgccagaggagaaagtacctgcaccggtccctaaaaaggtggaagctccacct
gctgaagtgccagaagtgcccaagaagcccgtgcctgagaagaaggtgccagttcctgtt
cctaagaaagtagaggctccacctataaaagtgccagaggtgcccaagaagctcattcca
gaggaaaagaaaccaacacccattcagaaaaaaatggaagctccaccacccaaagtgcca
aagacacgggagccagtgccagttcctgtagctttacctcgggaagaggaagttccattt
gaagaagaaatttctcctgaagaggaagttttacctgaggaagaggaaattcttccagaa
gaggaggaagttcctcctgaggaagaagaagaggaagtgcctcctgaggaggaagaattt
gtacctgaagaagttcttccagaaattaaacccacggtgccagtacctgcacgagtgcct
gaggttaagaagaaagtgccagagaagaaagtgatcgttcctaagaaagaggaggctccc
cctgccacagttcctgaggtacctaagaaagtggaagaaatcattccccctacagaagag
gaagttccaccagttgaagtgtatgaggagcctgaagagcctattccagaagaagaaatc
ccagaagaaccacctagcatagaggaggttgaggaggtggtgccacctagagtgcctaaa
gtggttaagaaagcagtacctgaagcacctactcctgttcctaaaaaagtggaggcacca
ccagctaaagtgccaaagaaggttcctgaggaaaaagtacctgttcctgttcagaaaaaa
gaggcacctccagccaaagtgcccgaagtacaaaagaaagtcccagaaaagaaagttcca
gaaaagaaaatcccagaaaagagagtccctgtgcctaaaaaagaagctgttcccccagcg
aaagggatgactgtctttgaagaaaaaatatcagttgccttccacaaagaggaagtagta
agagaaagaatggaactagaagtagtggaagcacaagtggaagaagctcatgaaggagag
ttccatgaagtggaagaatattttgaagaagaagagttccatgaagtggaagaatttatc
aaagtagaaaaacatagatttgaagaagtacacaaagttgaagaaacccgtagggtaata
ggattcttagaagctgaagaagtggacgtatatgaaaaacccaaagctccgccaaaaggg
cctgagatatctgagaaagtcatccctccaaaaaaaccacccaccaaagttgttcctcga
aaagagccaccagctaaagtacctgaagcacccaagaaaattgtggaagaaaaagtacat
gttcctgaagagcccaagtttccaccagctaaagaagttgtccctgaaaagaaagcacca
gtggtgcctcctaaaaagccagaagtcccacctgttacagtgccggaggctcccaaagaa
gttgtccctgaaaagaaagtacctttggctcctcctaaaaagccagaagttccaccagcc
aaagtacccgaggtgccaaaagcagctgtccccgaaaagaaggtgcctgaagctattcct
cccaaaccagaaagtcctccccctgaagtgccagaggctcccaaagaagttgtccctgaa
aagaaagtgtctgtggcacctcctaaaaagccagaagctgtacctgttaaagtgccagag
gctcccaaagaagttgtccctgaaaagaaagtacctttggctcctcctaaaaagccagaa
gttccaccagccaaagtacccgaggtgccaaaagcagctgtccccgaaaagaaggtgcct
gaagctattcctcccaaatcagaaagtcctccccctgaagtgcatgaggagcctgaagaa
attgtctctgaagaaccgccagctgaagttgtggaagagccggagcccgtagctcctcca
aaagtgacaatgccacctaagaaacctgtcccagaaaagaaaccacctgctgttgctgcc
aaaaaacctgaaccaccacccatgaaagtgcccaaagtgcctaaggaagttgttcctgaa
aagaaagtgcccccagtggttctcaagaaaccgcaagtcccgcctgccaaagtgcctgaa
gttcccaaagaagtcgttccagaaaagagagtaactgttcccaaaatgccagaagtccca
ccagctaaagtgccagaagtgcctgagaaacctgtcgtagaagagaaaccagccgttcct
gttcccaagaaagtggagtctcctcctccagaagtatatgaagaacccgaggaaattgct
cctgaagaggaagtgccagttcctgttgtggaagaagaggaaccaaaagccccaccaccg
gcagtgcctgaagagcccaagaagattgttccagagaaaaaagttcctatcatcaaaaaa
ccagaagctccacctgccaaagaacctgaaccagaacctgaaaagaaggttattgagaaa
ccaaaattcaaaccaaagcccccagctcctgcacctgctccacctaaggaagatgtgaag
gagaaagcattccaacttaaagctgtttcgaagaaagttcctgaaaaacccgaggttcca
gaaaaagtggagcttaaacctgtgaaagtgcctggagttgaaaagaaagttcgcaaatta
cttccagagcctaaacctcaacccaaggaagaagtcgttctcaaaagcgttctaagaaag
agatctgaagaagaagaacctaaagtagaacctaaaaaagtagaaaaagttaaaaaacct
acagtaccagaaccacctccaaaagctgttgaagaggttgaagcacctccagctaagaaa
gaggaaaagaaaattcctgaaccggcaaaagtgcctgaaataaaaccagcaatacctctc
cctggacctgaagcaaaaccaaagcctgaaccagaagtgaaaacagtcaaaccgcctcct
gtggagcctgctccaacccccatcgctgccccagtgacagcaccagtagttgggaagaaa
gcagaagccaaacctaaagaggaggctgccaagccaaaaggtcccatcaaaggtgtggcc
aaaaagactccttcaccagtagaagctgaaaggaaaaagctaagaccaggaagtggtgga
gagaaacctcctgatgaagccccattcacctaccagctaaaggctgtgccactaaagttt
gtaaaagaaatcaaagacatcgtcttgaccgaagcagagtcggttggctcttctgcaatc
tttgaatgtttagtctccccctccactgcaattacaagctggatgaaagatggtagcagc
atccgggagagcccaaagcacaggttcatcgcagatggtaaagacagaaagctgcatatc
attgacgttcaactttctgatgctggcgaatacacctgtgttttacgtttgggaaataaa
gaaaagacctccacagctaaactgattgtagaagaacttcctgtgcgttttgtaaaaacg
cttgaagaggaagtcacagtggtcaaaggacagccattgtacctgagctgcgagttaaac
aaagaacgtgatgtagtctggaggaaggatgggaagattgtggtggagaaacctggcaaa
attgtgccaggcgtcattggcttgatgaaggccctcaccatcaacgatgcagatgacttc
gatgctgggacatacacggttactgtggaaaatgccaacaatctggagtgttcatcctgt
gtaaaagtagtagaaatcattagagactggctggtgaaacccatacgagatcagcatgtg
aaacccaaggggacagctgttttcacctgtcacatagcaagggacactccaaacattaag
tggttcaaaggatatgatgaaatcccctgggaaccaactgacaagactgagatagtgaaa
gagggaaattacgtacacctcaaaattaagaatgctgtgccagaggatatcgatgaatat
gcagttgaaattgaagggaaaagataccctgcaaagctgacacttggagagcgtgaggtt
gaattgcttaaaccaatagaagatgttaccatttttgagaaagaaagtgcaagctttgat
gcagaaatctcagaggaagacgtccctgggcaatggaagctgaagggagaacttctaagg
ccctcacctacttgtgaaatcaaagcagaaggtgggaaacgcttcttaactttgcacaaa
gtcaagctggaccaagctggtgaagtcctctaccaggcatttaacgcagtcacaactgcc
atcctgacagtgaaagaaatcgaacttgactttgctgtgcccctgaaggatgtcactgtt
ccagaaaagcgacaggctcggtttgaatgtgtcctcactcgagaggcaaatgtcatatgg
tctaaaggacctgatataatcaagtcatctgacaagtttgacatcattgttgatgggaag
aaacacattcttgttatcaatgattctcaatttgatgacgaaggggtctatactgctgag
gtggcgggcaagaagacctcggcacaattatttgtgacaggggtaagattgaatttcatt
tcgcctcttgaagatcaaacagtgaaagaaggtcaaacagcaacttttgtttgtgaactt
tctcatgaaaaaatgcatgtagtctggtacaaaaatgatgccaaactccacacaagcaga
actgtactcatctcatctgagggcaagattcacaaattggagatgagagaagtgacgttg
gatgatatatcccagatacgagctcaagttaaggacctgaagtccacagcaaacctgaag
gtcttagaggctgatccctacttcaccgtgaaattacatgacaaaactggagttgaaaag
gatgagattattctgaagtgtgaagtgagcaaagatgtgccagtgaaatggttcaaagac
ggcgaagagattgtaccttcaaccaaacactctatgaagtcagatggcctgcgccgcatc
ttaaagatcaaaaaggccgaatttagcgacaaaggcgaatatgtgtgtgactgtggcaca
gacaagacaaaagcaaatgttaatgtggaggctcgactaataaaagtggaaaaacctctg
tatggagtagaattgtttgtcggtgaaacggctcgctttgaaattgaactttctgaacca
gacgtccatggccagtggaagttaaaaggagagcctttgactgcatctcctgactgtgaa
attattgaagatgggaagaagcatattcttgtcctttataactgccagctggatatgaca
ggagaggtgtccttccaggctgccaatgccaaatctgcagccaatctgaaagtgaaagaa
ctgccgcttatcttcatcacccctctcagcgacgttaaagtctttgagaaagacgaagct
aagtttgagtgtgaagtgtccagggagcccaaaaccttccgttggctgaaaggaacccag
gaaatcacaggggatgacaaagtggagcttataaaggatggcactaagcattcaatggtg
atcaaatccgctgcttttgaagatgaagcaaaatacatgtttgaagctgaagacaagcac
accagtgccaaactgatcattgaaggaatccggctcaaattcctcactccactcaaggat
gtgacagccaaagagagagagagtgcggtgtttactgtggagctgtcccacgacaatatc
ccagtgaagtggttcaagaacgaccagcgcctgcataccagcaaggtggtctccatgcac
gatgaggggaaaacccactccatcaccttcaaagacctctctcttgatgatacctctcaa
attaaagtggaggctatgggaataagttcagaagctaaactcacggtgcttgagggagat
ccatactttacaggaaagcttcaagattataccgccgtagagaaagacgaagtgattctg
cagtgtgaaattagcaaagcagatgcgccagtgaaatggtttaaggatggaaaggaaata
aagccatctaaaaatgttgttattaaggcagatggcaagaagcgcatgctaatcctaaag
aaagccctgaaatcagacataggagagtacacctgtgactgcggaacagataagacctca
ggaaagcttgacattgaggatcgggaaataaaactgctgcgccccctgtacagtgtggag
gtgatggagactgagacagcccgttttgaaactgaaatctctgaagatgacatccatgcc
agctggaaactcaagggagaggcactactccaaacacctgattgtgagatcaaggaagaa
ggcaaagtgcacttccttatcctgcacaattgccgcctggaccaggccggtggggtggat
ttccaagccgctaatgttaaatctagcgcccacctccgagtaaaaccacgagtaattggt
cttctgaggcctctgaaggatgtcacagtgactgcaggggaaacagccaccttcgactgc
gagctctcttatgaggatatcccagtggaatggtatctcaaagggaagaagctagagccc
agcgacaaggtggtcacacgttcagaaggaagagttcatacacttactctgagggatgta
aagttagaagatgctggagaagtccaactaacagcaaaggatttcaaaactcaagccaac
ctctttgtgaaagaacccccagttgaattcactaaacctcttgaggaccagacggtcgaa
gaggaagccactgcaatattggagtgtgaagtatccagagaaaatgctaaggtgaaatgg
ttcaaaaatggtacagaaattctcaaaagcaagaagtatgaaattgttgctgatggcagg
gtcagaaaactcattatacatggctgtaccccagaggatattaaaacatacacttgtgat
gctaaggattttaagacttcctgtaacctgaatgtcgtgccacctcacgtggaattctta
agaccacttactgatcttcaagttaaagaaaaagaaatggctcggtttgagtgtgaaatt
tcccaagaaaatgcgaaggttcagtggttcaaagatggtgctgaaattaaaaagggcaaa
aaatatgacatcatatctaagggagcagtacgcattcttgtcatcaacaaatgtctgctg
gatgatgaagcagaatattcctgtgaagtaagaacagcacgaacttctggcatgctgact
gtgctggaagaagaagctatctttacaaaaaatcttgccaacattgaagttagtgaaaca
gacactatcaaactggtctgtgaagtttccaagcctggagcagaagtgatctggtacaaa
ggggatgaagagatcatcgaaacaggaagatatgaaatactaactgatgggcgaaagaga
gtcctggtcattcagaatgcgcaacttgaggatacaggcagctacaactgccggctccca
agttctcgaactgatggcaaagtcaaagtacatgaacttgctgctgaatttatctcaaag
cctcaaaaccttgaaatacttgaaggagaaaaggctgaatttgtctgctctatatcgaag
gaaagctttgaagtccagtggaagagggatgatatgacacttgaatctggagataaatat
gacatcattgctgatggcaaaaagaggatcctagttgtgaaagatgccacattacaagat
atgggcacttatgttgtcatggttggggccgccagagcagcagctcacttgacagtaatt
gaaaaactcaagatcatagttcctcttaaggacacccgcgtgaaagaacaacaagaagtt
atcttcaattgtgaagtcaatactgaaggtgcaaaagccaaatggttcagaaatgaagaa
gctatattcgatagttcaaaatatatcattctccaaaaggacctggtctacaccctcaga
ataagagatgcacgattagatgatcaagccaactacaacgtgtctctgaccaacaataga
ggtgaaaatgtaaagagtgcagccaatctcatagtggaagaggaagacctcaggattgtt
gagcctcttcgagatattgaaacaatggaaaagaaatctgtcacattctggtgcaaggtg
aatcgtctcaacgtcacattgaagtggaccaaaaatggagaagaagtggcttttgacaac
cgtattatatacagagttgataaatataagcactctttaattattaaggactgtggcttc
ccagatgagggcgaatacattgtcactgctggacaagataaatccgtcgctgagcttctc
atcatagaagctcctacagaatttgtggaacacttggaagaccagacggtcactgagttc
gatgatgctgtcttctcctgccagctctccagagagaaagcaaatgtaaaatggtacaga
aatgggagagaaatcaaagaaggcaaaaaatacaaatttgaaaaagatggaagcatacac
agactcattatcaaagattgcaggctggatgatgaatgtgaatatgcttgtggagtagaa
gacaggaagtcacgagctagactttttgtggaagaaatccctgttgagatcatcaggcct
cctcaagatattctcgaagcccctggtgctgatgttatctttttggctgagctcaacaaa
gataaggtggaagttcagtggctaagaaataacatgattgttgtccagggtgacaaacac
cagatgatgagtgaaggaaagatacacaggctacaaatttgtgatattaggccccgtgac
cagggtgaatacagatttattgccaaagacaaagaagccagagctaagcttgaactggca
gctgctcccaaaatcaagacagctgatcaagatcttgtggttgatgttggccagcctctg
acaatggtggtgccctatgatgcctaccctaaagcagaagctgagtggtttaaagaaaat
gaagctctgtcatcaaaaactgttgatactacagctgaacagacttccttcagaatttta
gaagccaagaaaggagataaaggaaggtataaaattgtgcttcagaacaaacatggaaaa
gcagaagcattcatcaatttacaagttattgatgttcctgggccagtacgtaacttagaa
gtgacagaaacatttgatggtgaagtgggccttgcctgggaagaaccattaactgatggt
ggaagcaaaatcataggttatgttgttgaaagacgtgacatcaagagaaagacctgggtt
ctggccactgaccgtgcagacagttgtgagtttactgtcactggactacaaaaaggagga
gttgaatatctattccgtgtgagtgcaagaaacagagttggcactggtgaaccagtagaa
actgacaatcctgtagaagcaaggagcaaatatgatgttccaggccctcctttgaatgta
accatcactgatgtgaatagatttggtgtttcactaacatgggaaccaccagagtatgat
ggaggtgctgagatcacaaactacgtcattgaattaagggacaagacttctatcaggtgg
gacactgccatgacagtaagagctgaagacctatcggcaactgtcactgatgtggtggaa
ggacaggagtatagtttccgggtcagagcccaaaaccgaattggagttggaaaaccaagt
gcagccacacccttcgtcaaagttgctgatccaattgagagaccaagtcctcctgtgaac
ttaaattcgtcagatcagactcagtcatcagttcagctcacatgggaacctcctctgaaa
gatggaggaagcccaatcctgggctatataatagagcgatgtgaagaagggaaagataac
tggattcgttgcaatatgaaactggtccctgaactgacctacaaggttactggattacag
aaaggaaagaaatatttatatcgagtatctgcagaaaatgaagctggtgtttcagatcca
tctgaaattcttggtcctctaactgctgatgatgcttttgttgagccaacaatggattta
agtgcatttaaagatggtctggaaattattgtcccaaatcccatcaagatcctagttcca
agtacaggctatccaaggccaactgcaacctggtctctaggagatcaaatactagaagaa
ggggatcgtgtgaaaatgaaaaccttatctgcctatgccgagcttgtcatctctccaagt
gaacgtccagacaagggcatttatacactgaaactggaaaatcctgtgaaggcaatttct
ggggaaattgatgtcaatgtaattgctcgcccaagtgcacccaaagaactgaaatttggt
gacataaccaaggactcagttcatttgacttgggaaccaccagacgatgatggaggaagt
ccattaactggctatgttgttgaaaagcgagaagtcagtcggaaaacatggactaaagtt
atagactttgtgactgacttagaattcacagttcctgatcttgttcaaggaaaagaatat
ttatttaaagtctgtgctcggaacaagtgtggccctggagaacctgcatatattgatgaa
cctgtaaatatgtcagctcctgcaacggtacctgacccaccagagaatgttaagtggaga
gatcgaacagccaagagcattttcctacaatgggatccgcctaaatatgatggtggttca
cgtattaagggatacttagttgaaaaatgtccacgtggttctgatcgatgggtcgcctgt
ggagaaccagttgcagaaacaaaaatggaagtaacaggtcttgaagaaggccagtggtat
tcctaccgtgttaaggccttaaacaggctaggtgctagcaaaccaagcaaacccacagat
gaaatccaggctgtggacactcaagaggctccagaaattttccttgacgtgaagctcctt
gccggtctcactgtgaaagcaggaactaaaattgaacttcctgccactgtaactggaaaa
cctgaacctaaaataacttggacgaaggctgataagcttctgaaacaggacaaaagaatc
accattgaaaatgttcctaacaaatccacagtgactatcattgatagtaagagaagtgat
actggcacatacatcattgaggctgtgaatgcctgtggtcgggccactgccgtggtagaa
gtgaatgtcctagataagccgggaccaccagccgcttttgacatcacagaagtgaccaat
gagtcatgtcttctaacatggaatcccccacgggatgatggtggatctaaagttacaaac
tatgttgtggagagaaaagcaacagacagtgatatgtggcacaagctctcatcaactgtc
aaggatacaaacttcaaggcaaccaaattaacacccaataaagaatacctcttcagagtt
gctgcagaaaacatgtacggcgttggtgagccagtgcaggccgctccaataacagccaaa
tttcaatttgatccacctggacctccaactcgcctagaaccttctgatatcactaaagat
gcagtgactctcacatggtgtgagccagacgacgatggtggcagcccaatcactggatac
tgggttgaaagattagatcctgatactgataaatgggttagatgcaataagatgccagta
aaggacacaacatacagagtgaaaggtctcaccaataagaagaaatacagattccgtgtg
ttggctgaaaatcttgctggacctggaaaaccaagtagatcaactgaaccaatcttaata
aaggatcccatagatcctccgtggccccctggaaaaccaactgtgaaagatgtaggcaaa
acatcattagtattgaattggacaaagccagaacacgatggaggggcaaagattgagtct
tatgtcattgaaatgctaaagactggaacagatgactgggtccgagtggctgaaggagtt
cccaccactcagcatttgctcccagggctcatggaagggcaggaatactctttccgagtc
agagctgtgaacaaggcaggggaaagtgaacccagcgaacccagtgaccctgtgctttgt
cgggagaagctatatcctccatcaccacctcgctggcttgaagttattaatatcacaaaa
aatacagcagacctgaagtggacagtccctgagaaagatggaggatcccccatcaccaac
tacattgtggaaaagagagatgtgaggcgaaaaggctggcaaacagtagacaccactgtc
aaggacaccaagtgtacagtaaccccactaacagaaggcgctttatatgtgttccgagtt
gctgcagaaaatgccataggacaaagtgactactgtgaaattgaggactccgtcctggcc
aaagacacctttaccacccccgggccaccctatgctctgacagttgttgatgtgacaaaa
cgacatgttgacctgaagtgggaaccacctaaaaatgatggtggaagaccaatacaaaga
tatatcattgagaagaaagaaaagttaggtacccgttgggtgaaagctggaaagacctca
gggccagactgtaacttcagagtaactgatgtcattgaaggcacagaagtccagtttcaa
gttcgggcagaaaatgaagccggagttggtcacccaagtgaacccacagaaatcttgtca
attgaagatccgacaagtcctccttcaccaccccttgacctgcatgtgactgatgctggt
agaaaccacattgccattgcttggaagcctccagagaaaaatggtggaagtcctattata
ggataccatgttgaaatgtgtccagtaggcactgaaaaatggatgcgagttaattctcgc
cccataaaagacttgaaattcaaggttgaagaaggtgttgttcctgacaaggagtatgtt
ctgagagtgagagctgtcaatgctgttggtgtcagtgagccatctgaaatatccgaaaat
gtggttgccaaagacccagactgcaagccaacgattgatctggagactcatgacattgtt
gttattgaaggtgaaagattaaacattcctgttcccttcagagctgtcccagttccaact
gttagttggcataaagatggcaaagaagttaaagcaagtgataggttaacaatgaagagc
gatcacatctctgcaaatctggaagttcccaagagtgtccatgcagatgctggagtttat
accattacagtggagaataagcttggctcagcaactgcctcaatcaatgtcaaagtcata
ggccttcctggaccatgcaaagatattaaagcaagtgacgtgaccaagagttcttgtaaa
ttaacctgggaacctccagaatatgatggtggaagcccaattctacattatgtcctggaa
cgcagagaagctgggaggaggacatatataccagtcatgtccggtgagaataaactaact
tggactgtaaaagatctcataccaaacggcgagtacttcttccgtgttaaagctgtcaac
aagattggtggaggcgaatatattgaactgaaaaatccagtcattgctcaagatccaaag
caaccccctgatccgcctgtagatgttgaggttcataatcctacagctgaggcaatgact
attacatggaagccacctttgtacgatggagggagcaagataatgggttatatcatagag
aagattgctaagggtgaagacaggtggaagagatgcaatgagcacctggtaccaatcctg
acctatacagcaaaaggacttgaagagggaaaggaataccagttccgtgtgcgagccgaa
aatgccgctggcattggtgaaccttctcgggccactcctccaactaaagctgtagatcct
attgatgccccaaagatcattatgagaacaagtctagaagtaagacgaggtgatgaaata
gcacttgatgcaacaatttctgggtcaccttacccaactattacatggctaaaggatgaa
aatgttattacaccagaggaaattaagaagcgagtagcacccacagttaggaggaagaag
ggtgaagctcaagaagaagaaccatttgtcctgcctctggcggagcgtttgagcatcgac
aatagtaaaaaaggagaatctcagctacgtgtccgagattcccttcgaccggaccatggc
cagtacatgatcaaagctgaaaatgaccatggtattgcaaaagctccttgtaccgtcagt
gtgctggatacaccagggccaccaatcaactttgtatttgaggatattagaaagaactca
gtcctctgcaaatgggaaccaccccttgatgatggtggcagtgaaattataaactacatt
ttggaaaagaaagaaaagacaaaacctgactcagactggattatcatcacttcaacactc
agacattgcaaatattcagtgacaaagctgattgaaggaaaagagtatctcttccgtgta
agagctgaaaataggttcgggcctggaccaccttgtgtttcaaagccacttacagctaaa
gatccatttgaaccacctgatgcacctgataagcccactgtggaagatgttacgagcagc
agtatgctagtgaaatggaatgaaccaaaggataatggaagccccatcttgggttactgg
cttgaaaaacgtgaggttaatagttcacattggtctcgtgtcaacagaagccttctgaat
gctttgaagaccaatgtagaaggcttattagaaggactcacctatgtcttcagagtatgt
gccgaaaatgctgctggacctggaaaattcagtcccccttcagatcccaaaacagcgcat
gatccaatctctccacctggaccacctgtcccaagagtcgctgacacaagctccacaact
attgaattagaatgggaacccccaactttcaatggtggtggggaaattattggctacttt
gtcgataagcagctggttggcacaaatgaatggtcacgctgcacagagaagatggtcaag
gtccgtaagtacactgtcaaagaaatccgagagggtgctgattacaagcttcgagtgagt
gccgtcaatgctgcaggcgaaggaccacctggagaaacggaacctgttacagtggctgaa
ccacaagagcctccaactgtggaactagatgtttctgttaaggctggaatacagataatg
gctgggaagactctcagaattccagctgtggtaactggccgtccagagcctacaagagtg
tggaccgtagaagaaggagagctggataaagaccgtgttgtaatagagaacgttggaacc
aaatctgaactaattatcaaggaagcactgagaaaagatcgtggcagatatgtgattaca
gctaccaatagctgtggttccaaatttgcagcagccagggtagaggtgtttgatgtccct
ggtccagttcttgacttaaaacctgttgtgataaacagaaagatgtgtctgctgaactgg
tctgatccagcagatgatggaggaagtgaaatcacaggctttattattgaaagaaaagaa
gccaagatgcatacttggagacaaccaatagagactgagagatctaaatgtgatatcaca
ggcctctttgagggacaagaatataagttccgtgtgattgccaagaacaagtttggctgt
ggccctcctgtggaaataggaccaattcttgcagttgatccactaggtcctccaacggct
cctgagaggctcacatatacagaaaggaccaagtccactatcacccttgactggaaagag
ccccgcagtgatggtggcagccctgtccaaggctatatcattgaaaaacggcgtcacgac
aaacctgactttgaaagagttaacaagagactctgcccaaccacatcttttctggttgaa
aatcttgatgaacgccaaatgtatgagttccgtgtcaaagcggtcaatgcagttggtgaa
agtgaaccatccctgccccttaatgtggtcatacaagatgatgaagtgcctccaaatatt
aaattgcgcctgtctgttcgaggagacactatcaaggttaaggcaggagagcctgttaac
attcccgcagatgtgacaggccttccaatgcctaagattgagtggtccaagaatgacact
gtgattgaaaaacccactgatgcactgaagataaccaaggaagaagtatcccgaagtgag
gcaaagactgagctcagcattcccaaagcagtccgtgaggacaaaggcacttacacgatt
actgcttccaatcgcctaggctctgtcttccgaaatgttcatgttgaagtatatgatcgt
ccatccccaccaagaaatcttgctgttactgatattaaagccgaatcttgctatttaaca
tgggatgcccctctagacaatggtggcagtgaaatcacccattatgtcattgacaaacgt
gatgcaagtaggaagaaatctgaatgggaggaagtcaccaacactgctgtagagaggaga
tatgggatctggaaacttatccccaatggtcagtatgagttccgagttagggcagtgaat
aaatacggaatcagtgatgactgcaaatcggataaagtagtcattcaagatccttatcgc
cttcctggacctccgggaaaaccaaaagttttggatcgcaccaaaggatcgatgctagtg
agctggactcctccttcggataatggtggctctccaattactggctactggctggagaag
agagaagagggaagtgcctactggtcacgtgttagccgagcaccaataaccaaagtggga
ttgaaaggggtggaatttaatgttccccgtttgattgaaggtgttaaataccagttcaga
gcaatggcaataaatgctgcaggaattggccctcccagtgaaccatcagatccagctgtt
gcaggagatcccatatatccacctgggccaccttcttgcccagaggtaaaagataaaaca
aagtcaagtatctcgctagcatggaaacctccagccaaagacggtggcagtccaatcaaa
ggatacattgtagaaatgcaagaagaaggtaccactgactggaaaagagtaaatgaacca
gataaacttctaactacctgtgaatgtgtggtgccgaatttgaaagaacttagaaagtac
agattcagagtgaaagctgtcaatgaagctggtgaatctgaaccaagtgatacaactgga
gagatccctgcaactgatattcaagaggcaccagaagtttacattgacattggtgcacag
gactgtctggtttgtcaagctggctcacagattaggatacctgctgtcatcaagggacgc
ccaacaccaaaatcatcttgggaatttgatgggaaggcaaagaaggcaatgaaggatgga
gttcatgatatacctgaagatgcacagctggagactgctgaaaactcatcagtaataatt
attccggagtgtaaacgatctcattcaggcaaatacagcatcacagccaagaataaagca
ggacaaaagactgcaagttgcagagttaaagtcatggatgtaccagggccacccaaagat
ctgaaagtcactgacatcacaaggggtagttgcagacttacatggaagatgccagatgat
gatggaggagacagaatcaaaggctatgttatcgagaagaagactattgatggaaaagcc
tggacgaaagtcaatccaaactgtggaagtaccacatttttagttcctgatctcatctct
gaacagcagtatttcttccgcgtacgtgcagaaaaccgttttggtattggcgcacctgtg
gaaaccgttcagaggaccacggccagagatccaatttatcctcctgatcctcctattaaa
ctcaagattggcctcataacaaagaacacggtacacctgtcgtggaaacccccaaagaat
gatggaggctcccctgtcacccactatattgttgagtgccttgcatgggaccctactggg
aaaaagaaagaagcatggaaacagtgcaataggcgtgatgtggaagaactggaatttacc
gtcgaagacctcgtagagggtggggaatatgaatttagagtcaaagctgtcaatgctgca
ggagtcagcaaaccttcagctactgttggccctgtgattgtcaaagaccagacatgccca
ccatcaattgatctaaaggagttcatggaggttgaagaaggaactgatgttagcattgtg
gccaaaattaaaggcgtgccattcccaacactaacctggtttaaagctcctccaaagaag
cctgataataaagaacctgttatctatgacacacatatcaacaaactcgtggtggatgat
acttgcactttagttattccacagtctcgcaggagtgacactgccttatataccatcaca
gctgtgaataatctgggaacagcatcaaaggagatgagactgaatgttcttggtcgtcct
ggccctccagtgggaccaataaagtttgaatctatttcagcagaccaaatgacattatct
tggctcccacctaaagatgacggtgggtctaaaattacaaactatgtaattgagaaaaga
gaacctaataggaagacatgggtgcgtgtctccagtgaacctaaagagtgcacgttcaca
gttcccaaattgctagaaggccacgattatgtattccggatcatggcccagaacaaatat
ggcattggggagcctcttgacagtgaacctgaaacagcaagaaacctcttctctgtccca
ggagcaccagataaaccaacagttagcagtgtgactcgtaactccatgactgtcaactgg
gaagagccagaatatgacggaggctctcctgtgaccggatactggctagaaatgaaagac
accacttcaaagagatggaagagagttaaccgagacccaatcaaagccatgactttgggt
gtttcttataaaatgactggtcttattgaaggttctgattatcagttccgggtatacgct
atcaatgctgctggtgtgggtccagcaagtccaccatcagacccagtgacagctagagat
ccaattgcccctcctggtcctccatttccccaagtcacagactggactaaatcatctgca
gatttggagtggacccccccactaaaagacggtggatccaaagtaactggatacattgtt
gaatataaagaagaaggaaaagaagagtgggaaaaggctaaagataaagaagtgagagga
accaaacttgttgtgacaggattaaaagaaggagcattctacagatttagagttagagca
gtcaacattgcaggcattggagagcctggggaagtcacagatgccattgaaatgaaggac
cgtattgtgtcacctgatcttcagctggatgccagcgtcagagacagaattgtggtccat
gctggaggagtgatccggatcattgcctatgtgtctgggaaacctcctccaaccgtcacc
tggagcatgaatgaaagagcattacctcaagaagccaccattgaggacacagccattagc
tcatccatggtcattaagaattgccagaggagccaccaaggtgtttattctcttcttgcc
aaaaatgcagggggagaaaggaagaagacaattatcgttgatgtattagatgtgccaggt
cctgttggaacaccattcctggctgacaacctaacaaatgactcctgcaagctgacatgg
ttttctccagaagatgatggaggctctccaatcaccaattatgttattcaaaagcgggaa
gctgaccgtagagcatggaccccagtgacatacacagttacccgacaaaacgctaccgtc
cagggtctcattcaaggaaaagcctactttttccgaattgcagctgaaaatagtattggc
ataggcccttttgttgaaacaccaaatgaaattgtcatcagagatccaataactgtacca
gagcgtcccgaagacctggaagttaaagaagttactaaaaattctgttagtttgacttgg
aatcctccaaagtatgacggtggatcagaaattattaactatgtcctagaaagccgtctc
attggaactgagaaattccacaaagttacacaggacaacttgcttagcaggaaatatact
gttaaaggcttaaaagaaggtgatacatatgagtaccgtgtcagtgccgtcaatattgtt
ggacagggcaagccatcattttgcaccaagccaatcacttgcaaggatgagctggctcct
ccaacacttgaccttgacttcagagataagatcacaattcgagttggtgaagcttttgcc
ctcactggccattattcaggcaaaccaaaacctaaggttacttggttcaaagatgaagct
gatgtggtagaagatgatcgcactcatataaagaccactccaacaacacttgctctagag
aagatcaaggccaaacgttcagacactggcaaatactctgtggttgtggagaatagtacg
ggctctaggaaaggtttctgtcaagttaatgtggttgaccgtcctggaccaccagtagga
ccagttacttttgacgaggtgaccaaagagtacatggttatctcttggaagccaccttta
gatgatggaggcagtgaaattaccaattatattattgagaagaatgaggtgggcaaggat
atttggatgcctgtgacatctgcaagtgctaaaccaacatgcaaagtctctaaactgctt
gaaggaaaagattatattttccggatacgtgctgaaaatctgtatggaataagtgatcct
ctggtatctgactcaatgaaagccaaagatcgtttcagggttcctgatgcacctgagcag
ccaattgttacagaaattaccaaagactctgcattagtaacttggaacaagccaaatgat
ggaggaaagcccataacaaactacattctggaaaagagggaaactatgtctaaacgatgg
gctagagttaccaaagagccaatccatccatacactaaatttagggttcctgatcttcta
gaagggtgtcaatatgaattccgggtttctgcagaaaatgaaattggtatcggagatcca
agcccaccatccaaaccattctttgctaaagatccaattgctaaaccaagtccacctgtt
aatcctgaagcaatagatacaacatgtaattcagttgacctaacttggcagccaccacgt
cgcgatggtgggagcaagattctgggttatattgttgagtaccagaaagttggagatgaa
gagtggagaagagccaatcacactcctgagtcatgtcctgaaactacatataaagtcact
ggtcttcgggaaggtcaaacctataaattcagagtactagcagtcaatgaagctggtgaa
tcagacccagctcatgttcctgagcctgtactagtaaaagacagacttgaaccccctgag
ttgattcttgatgccaacatggcaagagaacaacacataaaggttggtgatactctaaga
cttagtgccatcatcaaaggagtaccattcccaaaagtaacttggaaaaaaggagacaga
gaagctccaactaaagcaagaattgatgttactccagttggtagcaagctggaaattcgt
aatgctgcccatgaagatggtggaatttattccttaacagtggagaatccagctggttca
aaaactgtctcagtaaaagtacttgtgttagataagcctgggccgcctcgagatctggaa
gtcagtgaaattaggaaagattcttgctaccttacttggaaggaacctctggatgatggt
ggttctgttgttacaaattatgtggttgaaaggagagatgttgccagcgcccaatggtca
cctctctcaactacatcaaagaaaaagagtcactgggctaagcatcttaatgaaggcaat
cagtatctcttccgagtagctgctgagaaccagtatggacgtggtccttttgttgaaact
cctaaacccatcaaggctgtggatcctctacatcccccagggccacccaaggacctacac
cacgtagatgttgacaagactgaggtctcccttgtttggaataagccagatcgtgatggt
ggttctccaatcactggatatttggtggaatatcaagaagaaggaacacaagactggatt
aagttcaagactgtgacagaattagagtgtgttgttactggactacaacaaggaaagacc
tatagattccgtgtaaaagctgaaaatattgtaggtcttggtctccctgacacaactatt
ccaatagaatgtcaagaaaaattagtgcctccatctgtggaactggatgtgaaattaatt
gaaggcctcgtggtaaaagctggaactacagtcagattccctgccattataagaggtgta
ccctttcctaccgcaaagtggacaactgatgggagtgagattaatacagatgagcattac
acagttgaaactgacaacttctcgtcagtacttaccattaagaactgcttaaggagagac
actggggaataccaaatcacggtttccaatgcagctggcagcaaaacagtagctgtacat
cttactgtccttgatgttcctggtccaccaacaggtcctattgatattctggatattacc
cctgaacatatgactatctcatggctgccaccgaaggatgatggaggaagccctgtgata
aattatatcgttgagaaaaaagatacaagaaaagatacgtggggcgttgtctctgcggga
agcagtaagacaaagctgaaagtcccacatctgcaaaagggctgcgagtacgttttccga
gttagagcagagaataagatgggcgttggtccaccccttgactccacacctactgttgct
aaacataaattcaaccctccatcgcctcccggcaaaccagtggttactgacattactgaa
aatgctgcaacactgtcctggactctgccaaaatctgacggcggcagtccaataactggg
tactatgtggaacgtagagagataaccggcaagtgggtgagggtcaacaaaacccctata
gcggacctgaagtttcgggtgacaggactctatgagggaaatacatatgagtttagagtt
tttgctgaaaatctcgcaggactaagcaacccatccccaagttctgacccaataaaagcc
tgccggcccatcaaaccacctggaccacctattaatcctaaactgaaagataagaccaaa
gagacagccgacctggtgtggacgaagcccctcagcgatgggggtagccccattctaggc
tatgtcgtagagtgtcagaaggctggtaccacccagtggaacaggataaacaaggatgag
ctcatcaggcagtgcgcctttacagtaccgggactgatcgaaggaaccgagtataggttc
cgtataaaggcagctaatgtagtgggggagggagagccaagagaactgccagaatctgtg
atggcaaaagacatccttcatcctccagaagtagagctcgacgttacctgtcgcgacgtc
attaccgttagggtgggccaaacgatccacattcttgctcgggtcaaaggcagacctcaa
ccagacataacttggacaaaggaaggcaaagtattggtccgcgaaaagcgggttgacatg
attcacgatctgcctcgtgttgagttacaaattaaagaagctgttagagctgatcacggc
aagtatatcatctcagctaagaacagcagcggacatgcccaaggttccgctatcgttaat
gtgcttgacagacctgggccttgccagaatttaagggttagcaatgtaaacaaagagaac
tgtacaatttcttgggaaaacccactagataatggtggctcagagataacaaacttcata
gtggaaagtcgcaaaccaaaccagaaaggctggtcaattgttgcttcggatgtcactaag
cgattaatcaaggccaaccttttagccaacaatgaatactatttccgagtttgtgcagag
aataaagtaggtgttgggccaaccattgaaacaaaaactccaattctggctattaaccct
attgatagaccaggagagcctgaaaaccttcacattgcagataaaggaaagacattcgtc
tatctaaagtggcggcggcctgattatgatggtggcagcccaaatctatcgtatcatgtt
gagaggaggctgaagggttctgctgactgggaaagagtacataaaggaagcattaaagaa
acccacttcatggttgacaaatgcgttgaaaaccagatttatgagttcagagtacaaaca
aagaatgaaggtggggaaagtgactgggtgaagacagaggaagttgttgtgaaggaagat
ttgcagaaaccagtacttgatctgaaattaagtggtgtgctaactgtcaaagcaggggag
actattagactggaggcaggtgttagaggcaaaccatttccagaagtttcatggaccaag
gacaaagatgctacagacttaacaagatcaccaagggtcaagattgatactagtgctgat
tcatctaaattttctcttactaaagcaaagcgaagtgatggtggtaaatatgtaattaca
gcaactaacactgctggcagttttgtggcctatgccactgtcaatgttttagataagcct
ggtcctgtaagaaatctgaaaatttctgatgtgaacagtgataggtgtactattcgctgg
gatccaccagaggacgatggtggctgtgaaatccaaaactatattctagaaaaatgtgag
agcaaacggatggtttggtctacctattcttctgctgtcttaacacctggtgctacagta
acacgtctcatagaaggcaatgaatatattttcagagtccgtgcagaaaataaaataggc
acagggccaccaacagaaagtaagccagttattgcaaaaaccaaatttgatagacctggg
cggcctgatcctccagatgtcactaaagtaagcaaagaagaaatgactgtggtttggagt
ccacctgaatatgatggtgggaagtccatcacaggatactttttggagaaaaaggaaaaa
cattcaatacgatgggtcccggttaacaagagtgcaatccctgagagacgtttgaaagta
cagaatctcttcccaggacatgaatatcagttccgtgtcaaggcagaaaatgaaattgga
attggagaaccatctttgccatcaagaccagtggtggcaaaagaccccatagaaccacct
ggtccaccaaccaatctcaaagtggttgatacaaccaaaaattccataactcttggatgg
ggaaaaccagtgtatgacggtggcgcaccgatacttggatatgttgtggaaatgagaccc
aaaaaagaagatgcatcacctgacgaaggctggaaaaggtgcaatgctccggctcagctt
gttcgcatggaattcactgctaccagtttggacgaaaaccaggaatatgagttcagggtg
tgtgcccaaaaccaggttggcattgggcgccctgcagaactaaaggatgccattaaacct
aaagaaatcttggaacctccggagattgatttggatgccagcatgaggaaactggtcaca
gtgagagcaggatgcccaattcgactgtttgccatagtgagagggcgaccagcccctaaa
gtcacttggcggaaagtgggcattgataatgtggtcagaaaaggacaagtcgatctggtc
gatactatggccttccttgtcatccccaactctactcgtgatgactcaggaaaatattcc
ttgacacttgtgaacccagctggagaaaaggccgtgttcgtgaatgtcagagtattagac
actcccggacctgtgtctgatttgaaagtttcggatgtcactaaaacatcatgccacatc
tcctgggcccctcctgagaacgatggtgggagccaagtgacgcattatattgtggagaaa
cgtgaggcagagagaaagacgtggtcaacagttacaccagaagttaagaaaacgagcttc
caagtcaccaatcttgttgctgggaatgaatatttcttcagagtaactgctgtcaatgag
tatggccccggtgtcccaacagaagtccccaaaccagtgcttgcatcagatcctctaagt
gagccggatcccccaaggaaactagaagttactgaaatgaccaagaacagcgctacatta
gcctggctacctcccctgcgtgatggaggtgctaaaatcgatggctacatcataagttac
agagaggaagagcagcctgcagatcactggacagagtattcagtggttaaagatctcagc
cttgtcgtcactggcctcaaggaagggaagaaatacaaatttagagtagtggccagaaat
gctgttggagtcagtttgccaagagaagcagaaggagtgtatgaagccaaggaacagctg
ttgccaccaaagatcctcatgccagagcaaattactattaaagctgggaagaaactccga
gttgaagcccatgtgtatggaaagccccatccgaccagcaaatggaaaaaaggagaagat
gaagttgtcacatccagccacctggccgtgcataaagcagacagttcttcaattctgatc
ataaaagacgttaccaggaaagacagtggttactatagcctcactgcagagaacagttct
gggtcagacactcagaaaatcaaagtcatcgtcatggacgctcctggaccccctcagcct
ccgtttgacattactgatatagacgccgatgcttgctccctgtcatggcacatccctctg
gaagacggagggagcagcatcaccaattacatagtggagaagtgcgacgtaagccgaggc
gactgggtgacggctctagcttcagtgacaaaaacttcctgcagaatcggaaaactgatc
cccggccaggagtatatcttccgggtccgtgctgaaaaccgatttggcatttcagagcct
ctcacatctccaaagatgctggctaagttcccatttgatgttcctagtgaaccgaagaat
gcacgaatcactaaagtcaacaaagactgcatgtttgtggcctgggacagaccagacagt
gatgggggcagccccatcaccggctacttgattgaacgcaaagaaagaaacagtttgctc
tgggtgaaagctaatgatactcctgtgcggtcaactgaatatccctgtgttggccttatc
gaaggtcttgagtattcattcagaatctacgccctaaacaaagctggatccagcccacct
agcaaaccaacagaatatgtaactgcaagaatgccagttgatcctcctggaaagcctgaa
gttgttgatatttccaagagcactgtatccctcatctgggctcgtccaaagcatgacgga
ggcagcaaaattatcggctattttgtagaggcttgcaaacttcctggtgataagtgggta
cggtgcaatactacaccccaccagattccccaggaagagtacacagccactggcttagaa
gagaatgctcaatatcagttcagagcaatcgccaagacagcggtgaacatcagccagcct
tccgagccctccgatccagtgaccatcctcgcagaaaacgttcctcccaggatagaactg
ggtgtgaatatgaaatctttgcttactgtcaaagctggaactaatgtttgcctggatgct
actgtttttgggaaaccaatgccaacagtctcttggaagaaggaagacacactgctaaaa
ccagcagaaggcataaaaatggccaggaagcggaacctgtgcaccctggagctattcagt
gtgacccgaaaggactcaggagactataccattactgctgaaaattcaagcggttccaaa
tcagccaccattaagcttaaagtgttagataaaccaggtcctccggcatctgttaaaatc
aacaaaatgtactcagatcgtgcaatgctttcttgggaacctcctcttgaagatggaggc
tcagaaatcaccaactatattgttgacaaacgtgaaacgagcagacccaactgggcgcaa
gtctctgccacggtgcccatcaccagctgcagtgtggagaaacttatagagggccacgag
tatcagttccgaatttgcgctgaaaataagtatggcgtgggcgatccaatcctaactgaa
ccagcaattgctaaaaacccatacaacccacccggacgctgtgatcctcctgttatcagc
aacataaccaaagatcatatgaccgtgagctggaaggcaccagcagatgatggcggctca
cccatcactggctatttggttgaaaagcgggaaacccaggcagttaactggactaaggtc
aacagaaaacctgttatagaaagaactataaaagcaacaggtctccaagaaggcaccgaa
tacgagtttcgagttacagctataaataaggctggccccggcaagcccagtgatgcatcc
aaagctgcttatgctcgggaccctcagtatcctcctggcccaccagcttttcctaaagta
tatgatacaacccgtagctctgtgagtctgtcttggggcaagccagcctatgacggcggt
agccctatcattggttaccttgttgaagtaaaacgagctgactctgcaaactgggtgagg
tgcaatttaccagataagctacagaaaacccgctttgaggtgaccggcctgatggaaaac
gtagaatatcagttccgcgtatatgctgttaataaggttggatacagtgaccccagtgat
gtgccagacaaccactgtcccaaggacatcttaattccacctgagggagaacttgatgct
gatttgaggaaaacaatcatattacgtgctggagttacactgagactgtatgtaccagta
aaaggacgtccacctccaaagataacttggtctaaaccagatgccaatctaagagaaagg
attggactggacataaagtcaactgactttgacactttcttgcgctgtgaaaatgtgaac
aaatatgatgcaggaaaatatatcttgactctagagaacagctgtggcaaaaaggaatat
accattgtagtgaaagtgctggatactcctgggccaccggtcaatgtgactgttaaggaa
atatccaaagattcagcttatattacttgggatcctcccattattgatggtggaagcccc
atcataaactatgtggtagaaaaacgtgacgcagagaggaagtcctggtctacagtggca
actgagtgcccaaaaacaagcttcagagtatctaacttggaggagggaaaatcctacttc
ttcagggtgtttgctgaaaacgagtatggcattggtgatcctggtgaaacacgtgatgcc
gtcaaagcttctgaaacccctggaccagttgtggacctgaaagtgaggtctgtaactaag
tcatcttgtaccatcggctggaaaaagcctcgcagtgatggtggaagtcgaattattgga
tatgtagtcgatttcctaactgaagataataagtggcaacgagttatgaaatcattaaac
ttacagtactctgcaaaagatctgattgaagggaaggaatataccttcagagtgagtgct
gagaatgaaaatggagaaggaaccccaagcgaaatcatggctgtggcaaaggatgatgtt
gtggctcctgaccttgacttaaaggatctacctgatttgtgctacttggctaaagaaaat
agcaatttccgccttaagatccccataaaaggcaagccaactccatcagtatcctggaag
aaaggagaagatcctctagcgactgacacaagagtcagtgttgagtcatctgcagttaac
acaactcttgtagtacgtgattgccaaaaatctgatgctggaaaatacacgatcacactg
aagaatgttgctggaacgaaggaaggaactctctctataaaagttgttggcaagcctggc
atccccactggaccaatcagatttgatgaggtcacagcagaagccataaccttaaagtgg
ggtcctccaaaagatgacggaggttctgaaatcaccaattatatcttagagaagagagat
tctgtaaacaacaagtggatgacatgtgcctcggctgtccagaaaaccacctttagagta
accagacttcatgagggtatggaatataccttcagggtcagtgctgaaaacaaatatggt
gtaggagagggcctgaagtcggagccaattgttgctaaacatccatttgatgtgcccgat
gctcccccacctcctaatattgtggatgtcagacatgattcagtatctctaacttggact
gaccccaggaaaactggtggctctccaattacagggtatcacatcgagttcaaggaaaga
aacagccttttgtggaagagagctaacaagactcctattaggatgaaagacttcagagtg
acaggattaactgaaggtcttgaatatgaattccgagtgatggcaatcaatttagcagga
gtaggcaagccaagcctgccatcagagccagtcgtggcacttgatcccattgatcctcct
ggcaagcctgaggttatcagtgtaacaaggaactcagtgactctcatttggactgagcct
aaatacgatggtggtcataagttgaccggatacatagtggagaagcgggatctaccctcc
aaatcttggatgaaagccaaccatgttaatgtcccagattgtgcctttactgtaactgac
cttgtggagggtggaaaatacgaattcagaattagagcgaagaatacagccggtgctatc
agtgctccatcagaaagtacaggaaccattatttgcaaggacgaatatgaggcaccaacc
attgtccttgatcctaccataaaagatgggctaaccgttaaagcaggagataccattgtt
ttgagtgccattagcattcttggaaaaccccttccaaagtcaaattggtccagggaagga
aaagacattagactatcagatgtcgttcagataacttccaccccaacatcttccatgctt
gctgtcaagtatgccactagaaaagatgctggtgaatacaccatcactgctaccaatcct
tttggcacgaaggaggaacatgtgaaggtaacagttctcgatgtacctggtcccccaggt
cccattgaaatcagtaatgtttctgctgaaaaagcaacacttacgtggacaccacccttg
gaagatggtggctcaccaattaagtcttatgttcttgaaaagagggaaaccagccgactc
ttgtggaccacggttgccgaagatattcagtcttgcaggcatgtggcaaccaaacttatc
caaggaaatgagtacctcttccgggtctctgctgtcaaccagtatggcaaaggagaaccg
gtacagtctgaacctgtcaaaatggtagaccgattcggtccccctggccctcctgaaaaa
ccagaggtttcaaatgtcactaaaaacactgccactgtcagttggaaaaggccaattgat
gatggtggtagtgagataacaggatatcatgtagaaaggagagaaaagaaaggcctgcga
tgggtgagagcaacaaagacaccagtttccgatctcaggtgcaaagtaacaggactccaa
gaaggaaacacctacgaattccgcgtcagcgcagaaaacagagcgggaattggtccacct
agtgatgcttcaaatcttgtcttaatgaaagatgtggcatatcctccagggccaccttca
aatgcacgtgtcactgatactacaaagaaatctgcttctttagcatggggcaagcctcat
tatgatgggggactcgaaatcactggttatgttgtagagcatcaaaaagtaggagaggag
gcctggataaaagatacaacaggaactgccctcagaatcactgagtttgttgtccctgat
cttcagactaaagaaaaatacaattttagaatcagtgccatcaatgacgcaggtgttggg
gagccagcactggttccagatgttgaaattgtagaaagggaaatggctcctgatttcgaa
ctagatgctgagcttcgaagaactcttgttgtgagagcaggactcagtattagaatattt
gtgcccattaaaggtcgtcctgctcccgaagtgacatggaccaaagatgatatcaacctg
aaaaaccgagcaaacattgaaaacacagaatcattcactcttctgattatcccagaatgt
aacagatatgacacgggtaaatttgtgatgactattgaaaaccctgctgggaagaaaagt
ggctttgttaacgtcagagtcttggatacaccaggacccgtccttaacctgaggcctact
gacatcacaaaggacagtgtcaccctgcactgggacctccctctagtagatgggggctca
cgtataacaaactatatcgtggagaaacgagaagcaacacggaaatcttataccacagcc
accactaagtgccataaatgcacatacaaagttactggcttaactgaagggtgtgaatac
ttcttcagagtgatggcagagaatgaatatggaattggtgagccaacagaaacaacagag
ccggtgaaagcctctgaagcacctttacctccagaaagcctgaacattatggacataact
aagagcacagtgagcctggcgtggcctaaaccaaaacacgatggtggcagcaagatcact
ggctatgtgattgaagcccaaaggaaaggctctgaccagtggacccacatcacaaccgtg
aaggggctagaatgcgttgtgaagaatctaactgaaggggaagaatacaccttccaagtg
atggcagtgaacagtgcagggcgaagtgcccctagagaaagcagacctgtcgtcgtcaag
gagcagacaatgcttccagaattggatctccgtggcatttatcagaaactagtcattgcc
agagctggtgacaacatcaaagttgaaattccagtgcttggtcgaccaaagcccacagtt
acatggaaaaagggagaccaaattcttaaacagacacagagagttaatattgaaaataca
gcaacttcaaccatcttaaatatcaatgagtgtgtaagaagtgatagtgggccctatcca
ttaacagcaaggaacattgtaggagaggttggtgatgtcatcaccattcaagtccacgat
atcccaggaccacctactggaccaatcaaattcgatgaagtttcatctgattttataacc
ttctcttgggacccacctgagaatgatggaggtgtaccaataagcaattatgtagtagaa
atgcgacagactgacagtactacatgggttgagttagcgagcactgtcatacgcacgacc
tataaagccacccgccttactactggagtggaatatcaattccgggtaaaagctcaaaat
agatacggagttggaccaggcatcacatcagcatctatagttgccaactatccatttaag
gttcctgggcctcctggtacccctcaggtaactgcggttaccaaggactcaatgacaatt
agctggaacgaacctctctctgatggtggaagccccattttaggatatcacattgaaaga
aaagaacgaaatggtattctctggcagaatgtgagcaaagcattagtaccaggaaacatt
ttcaaatcaagtggacttacagatggtattgcttatgaattccgagtgatcgcagaaaac
atggcaggcaaaagcaagccaagcaagccatctgaacctatgcttgctttggatcccatt
gatccacctgggaaaccagttcctctaaatattactagacacacagtgacacttaaatgg
gctaagcctgaatatactggaggctttaaaattactagttatatagttgaaaaaagagac
cttcctaatggacggtggctgaaggccaacttcagcaacattttggagaatgaattcaca
gtcagtggcctgacagaagatgctgcgtatgaattccgtgtgattgccaaaaatgctgct
ggtgctatcagtccaccatctgagccatcagatgctatcacatgcagggatgacattgaa
gcaccaaggataatggtggatattaaatttaaggacacaattatactaaaagcaggtgaa
acattcaagctggaagctgatgtttcaggtcgccctcctccaacaatggaatggaccaaa
aatggaaaggagcttgaaggcaaaggaaaattagaaataaaaattgcagatttctctact
actttggtaaacaaggattcatcaagaagggatggtggtgcctatacccttacagcaact
aatcctgggggttttgccaaacacattttcaatgtcaaagttcttgatagacccggccca
cctgaaggacctttagctatatctgaggtgacatcagaaaaatgtgtattgtcctggttg
cctccactggacgatggaggtgccaaaattgaccattatgtagttcagaaacgtgaaacc
agcagattggcatggacaaatgtagccgcagaagtccaagtaacaaaactaaaggtcact
aaacttttgaaaggcaatgaatatatattccgcgtcatggcagtaaataaatacggagtt
ggagagccactggaatcagagcctgtgcttgcagtagatccttatggaccccctgatcca
cccaaaaaccctgaagtcacaaccattactaaagattcgatggttgtctgctggggacat
cctgactctgatggtggaagtgaaatcatcaattatattgtggaacggcgtgataaagct
gggcaacgctgggtgaaatgcaacaaaaaaactgttactgatttaagatttaaagtgtct
ggactgaccgaaggacatgaatatgagttcaggattatggccgagaatgctgctggaatc
agtgcaccaagtgctgccagtccattttataaggcttgtgacgctgtgtttaaacctggc
ccaccaggcaacccacgtgttctagattcaagcagatcatccatttcaattgcttggaat
aaacctatctatgatggtggttcagaaatcactgggtatatggttgagattgcccttcca
gaggaagatgaatggcagattgtcactccaccagctgggctcaaggcaacttcttacacc
atcaccaacctcatagagaatcaggaatataaaatccgcatctatgccatgaattctgaa
ggaattggggagcctgcacttgttcctggaactccaaaggctgaagacaggttgctgcct
ccagagattgaactggacgctgacctgcgcaaagttgttactataagagcttgttgtacc
ctgaggctttttgttccaatcaaaggaaggcctgtgcctgaggtgaagtggagccgggaa
catggagaatctttagataaagccagcattgaatccacaagctcttacaccctgcttatt
attggaaatgtaagcaggttcgacagtggcaaatacatactaactgtagaaaacagctca
ggcagcaaatctgcatttgtcaatgttagagtactagatacaccaggtcctccgcaggat
ctgaaggtaaaggaggtcactaagacatctgtcacattgacatgggatcctcctctcctt
gatggaggttcaaaaataaagaactatattgttgaaaagcgggaatccacaagaaaagca
tattcgactgttgcaacaaattgccacaagacttcctggaaggtagaccagcttcaagaa
ggctgtagttactattttagggttcttgctgaaaatgaatacggcatcgggctgcctgct
gagactgcagaatctgtgaaagcatcagaacgacctcttcctccaggaaaaataactttg
gtggatgtcacaagaaacagcgtgtcgctttcttgggagaaaccagagcatgatggaggc
agccgaattctaggctatattgtagaaatgcaaagcaaaggcagtgacaaatgggtcaca
tgtgccacagtcaaagtcaccgaagccactataactggattaattcagggtgaagaatac
tccttccgtgtttcagctcagaatgaaaagggcatcagtgatcctagacaactgagtgtg
ccagtaattgccaaagatctcgtaattccaccagccttcaaactcctcttcaatactttc
accgtactggcaggtgaagacctaaaagttgatgttccattcattggacgccctacacca
gctgtaacctggctgaaagacgaggtaccactgaagcagacaactagagtaaatgcagag
agcacagaaaataattcattattgacaataaaggaagcctgccgagaagatgttggacat
tacacagttaaactgactaactcagctggtgaagctactgaaattcttagtgttattgtt
cttgacaaaccagggcctccaactggaccagttaaaatagaggaagtgacagctgatagt
attactctttcctggggcccacctaagtatgatggtggaagttctatcaataattacatt
gtagaaaaacgggacacttccacaaccacctggcaaattgtgtcagctactgttgcgagg
acaacaataaaagcttgcagattaaagactggatgtgaatatcagtttaggattgcagct
gaaaacagatatggaaagagcacctacctcaattcagagcctattgtagcccagtatcca
ttcaaagttcctggtcctcctggcacaccatacgtaacactctcctccaaggacagcatg
gaagtacgatggaacgagccagtcagtgatggaggtagcaaagtcattggctatcatcta
gaacgcaaggaaagaaatagtatcctctgggttaagttgaataaaacacctattcctcag
accaagtttaaaacaactggcctcgaggaaggcattgaatatgaatttagagtctccgca
gagaacatcgtgggcattggcaagccaagtaaagtgtcagaatgctacgtagctcgtgac
ccatgtgatccaccagggcggccagaggcgatcattgtcacacggaattctgtgaccctt
cagtggaagaaacctacttatgatggtggaagcaaaatcactggttatattgttgagaag
aaagaactgcctgagggccgttggatgaaagctagttttacaaatgtcattgacactcaa
tttgaagtaactggcctagttgaagataatagatatgagttccgagttatagcccgaaat
gctgcaggagtgttgagcgagccatcagaaagcacaggagcaataacagcaagagatgag
gtagatccaccacgaataagtatggatcccaaatacaaagaaacaattgtggtccatgct
ggtgaatttttcaagattgatgcagatattcatggcaaaccaataccaactactcagtgg
ataaaaggtgatcaggaactatcaaatacagctcgattagaaataaagagcactgacttt
gccaccagtctcagtgtaaaggatgcagtacgtgttgacagtggaaattacatattgaag
gccaaaaatgttgcaggagagagatcagttactgtaaatgtcaaagttctagataaacca
gggccacctgaaggacctgttattataacaggagttacagcagaaaaatgcacactggct
tggaaacccccactacaggatggtgggagtgatatcataaattatattgtggaaagaaga
gaaaccagccgcttagtttggactgtggttgatgccaatgtgcaaactctcagctgcaag
gtgactaagcttcttgaaggcaatgaatatatgtttcgtataatggctgtaaacaaatat
ggtgttggcgaacctcttgaatctgaaccagtaattgctaagaatccatttgtagtacca
gatgcaccaaaggctccagaaatcacgacagtgacaaaggactcaatgattgttgtatgg
gaaaggccagcatctgatggtggcagtgaaattcttggatatgttcttgaaaaacgggat
aaagagggcattcgatggacaagatgccacaaacgtttgattggggaattgcgcttgagg
gtaaccggactcatagaaaatcacagttatgaattcagagtgtcagctgagaatgctgct
ggacttagtgaaccaagcccaccttccgcttaccaaaaggcttgtgatcctatttataaa
ccaggacctccaaacaatcccaaagtcacagatattaccagatcttctgtcttcctttct
tggagcaaaccaatatatgatggtggctgtgaaattcaaggatacattgttgaaaaatgt
gatgtgagcgttggtgaatggacaatgtgcactccaccaactgggatcaataaaacaaac
ttagaagtagagaagctgttggaaaagcacgagtacaacttccgtatctgtgctattaat
aaagctggagttggagaacatgctgatgtccctggacctgttatagttgaagaaaaactg
gaagctccagacattgatcttgacctagaactaaggaagattataaatataagagcaggt
ggctctttaaggttatttgttcctattaaaggtcgtcctacaccagaagtgaaatgggga
aagatggatggtgaaatccgagatgcagctataattgatgtcactagcagtttcacctct
cttgttcttgataatgtcaaccgatatgatagtggaaaatatactctcaccttagaaaac
agcagtggaacaaagtctgcctttgttactgtgagagtcctggacacaccaagtccacct
gttaacctgaaagtcacagaaatcactaaagactcagtatcaattacatgggaacctcct
ttgttggatggtggatccaaaatcaaaaattacattgttgagaaacgtgaagccacaaga
aaatcatatgctgcagttgtaacaaattgccataagaattcttggaaaatcgaccaactc
caagaaggttgcagttattactttagagtcacagctgaaaatgagtatggtattggcctt
cctgcccgcactgctgatccaattaaggttgcagaagtcccacaacctccaggaaaaata
actgtgaatgatgtcaccagaaacagtgtctccttgagttggacaaagcctgaacatgat
ggtggcagtaaaatcattcagtatattgtggaaatgcaagctaaacaaagtgagaaatgg
tcagagtgtgctcgagtcaagtcccttgaagcagtaattaccaacctaacacaaggagaa
gaatatctttttagagttgttgctgtaaatgaaaaggggagaagtgatcctaggtccctt
gcagttccaatagttgccaaagatctggtcattgagccagatgtaagacctgcattcaac
aattatagtgtacaggttggacaagatttgaaaatagaagtgccaatttctggacgtcct
aagccaaccattacatggactaaagatggtgttccactgaagcagactacaagaatcaat
gttactgattcacttgacctcaccatactcagtattaaagaagctcataaggatgatggt
ggacattatgaaatcacagttgctaatattgttggtcagaaaacagcatccattgaaatt
ataactctagataaacctgatcctccaaaaggacctgttaaatttgatgaagtcagtgct
gaaagtattacattatcttggaaccctccattatatactgggggttgccagatcaccaac
tacattgttcataaaagagatacaaccaccaccgtatgggatgttgtttctgcaactgtt
gccagaactacactcaaagtaaccaaactgaaaactggtacagaataccaattcagaata
tttgctgaaaacagatatggacaaagctttgccttagagtctgatccaattgtagctcaa
tatccctacaaagaaccaggccctccaggcacaccatttgtcacagccatttccaaagac
tccatggttgtacagtggcatgaaccaatcaataacggtggaagcccagtcataggttac
caccttgaaagaaaggagagaaatagtattttgtggacaaaagtcaacaaaactattatt
cacgacacccagtttaaagcagtcaatcttgaagaaggcattgaatatgaattcagagtt
tatgctgaaaatattgttggtgtaggcaaagcaagcaagaattctgaatgctatgtagcc
agagatccctgtgacccaccaggaactccagaagcaatcattgttaaaagaaatgagatc
actttacaatggaccaaacccgcatatgatggtggaagtatgattacgggttacattgta
gagaaacgtgatttgcctgagggtcgttggatgaaagccagtttcacaaatgtcattgaa
actcagtttactgtgtcaggtcttactgaagatcaaagatatgaattcagagtcattgca
aagaatgcagctggtacaataagtaaaccctctgacagtactggaccaataactgccaag
gatgaggttgaactcccaagaatttcaatggatccaaaattcagagacacaattgtggta
aatgctggagaaacattcaggcttgaggctgatgtccatggaaagcccctgcctaccatt
gagtggttaagaggagataaagaagttgaagaatctgctagatgtgaaataaaaaacaca
gatttcaaggctctacttgttataaaagatgctattagaattgatggtggacagtatatt
ttaagagcttccaatgtcgcaggttctaagtcattcccagtaaatgtgaaagtattagat
agaccaggacctccagaagggccagtccaggttaccggagtcacttctgaaaaatgcact
ttaacatggtctccaccactacaagatggtggcagtgacatttctcactatgttgttgaa
aagagagaaacaagccgacttgcctggactgttgttgcttcacaagttgtgaccaactct
ctgaaagtaaccaaactcttagaaggcaatgaatatattttccgtataatggctgtcaac
aaatacggtgttggagagcctttggaatctgcaccagtactgatgaaaaaccctttcgtg
cttcctggaccaccaaaaagcgtggaagtcacgaacattgccaaggactccatgactgtc
tgttggaaccgtccagatagtgatggtggaagtgagattattggttacattgtagagaaa
agagacaggagtggcattaggtggataaaatgtaataaacgccgaattacagacttgcgt
ctaagagttacaggattaacagaagatcatgaatatgaattccgagtctctgcagaaaat
gctgctggggttggggaaccaagtccagcgacagtttattataaggcttgtgatcctgtg
tttaaacctggcccgcccaccaatgcacacactgtagacaccactaaaaattcaattaca
gttgcctggggtaaacccatctatgatggtggcagtgagatcctaggatatgtagtagaa
atctgtaaagcagacgaagaagaatggcaaatagttactccaccaactggcctgaaagtc
actcgatttgaaatttcaaaactcattgaacaccaagagtataaaatacgagtctgtgcc
ctcaataaagttggtttaggtgaggctacatcagttcctggtactgagaaaccagaagat
aaacttgaagcacctgaacttgaccttgattctgaattaaggaaagggattgttgtaaga
gctggtggatctgctagaattcacattccattcaaaggccgtccaacacctgagatcact
tggtctcgagaggaaggtgaattcacagataaggttcaaattgaaaagggagtaaattat
acccatctatcaatagataactgtgatagaaatgatgctggaaaatatattctcaagctg
gaaaacagcagtggatctaaatctgcttttgtaactgtgaaagttcttgataccccagga
ccaccacagaacttggcagtcaaagaagtgaaaaaagattctgttatcttggtatgggaa
ccacccatcattgatggaggtgcaaaggtcaagaactatgttattgacaaacgtgagtca
accagaaaagcatacgctaatgtgagcaataaatgcagcaaaacaagctttaaagttgag
aatcttacagaaggagccatttattactttagagttatggctgaaaatgaatttggagtt
ggtgttccagtggaaaccgttgatgctgtgaaagctgctgaacctccttccccaccagga
aaagttacactcactgatgtgtcccagaccagtgcatcacttatgtgggagaaacctgaa
catgatggtggtagcagaatcctggggtatgttgttgaaatgcagtctaagggaactgaa
aaatggagtgttgtggctgaatccaaagtctgtaatgcagttgttactggtttgagctct
ggacaggagtaccagttccaagtcaaggctttcaatgagaagggaaaaagtgatccaaga
gtgcttggtgttcctgtcatagccaaggacttgactatacagcctagtcttaagttgcca
tttaacacatatactgtccaagctggagaagatcttaaaatcgaaattccagttattggc
cgaccaaaacctaaaatttcatggatcaaagatggtgagcctcttaaacagacaacaaga
gtaaatattgaggaaacagctacttcaactattttgcacattaaagaaagtaacaaagat
gactttggaaaatacaccgtaacagcaacaaatagtgcaggcgaggcaacagaaaatctc
agcattattattttggaaaagcctggccctccagttggaccagttcggtttgatgaagtt
agtgcagactttgtggtcatatcttgggaacctccagcctatactggtggctgccaaata
agcaactacattgtagagaagcgagatacaaccactaccacttggcagatcgtatcagca
acagttgcaagaacaacaattaaaataagcaaactgaaaacaggctcggagtaccagttt
agaatttttgcagaaaacaggtatggaaaaagtacccctctggattctaaaccagttatt
gtgcagtatccatttaaagtacctggaccacctggaactccttttgtgacatcaatctca
aaagatcaaatgcttgttcaatggcatgagccagttaatgatggagggagcaaagttatt
ggctaccatcttgaacagaaagaaaagaacagcattttatgggtcaaattaaataagact
cccattcaagataccaaattcaaaactactgggcttgatgaaggccttgagtatgagttc
aaagtttctgctgaaaatattgttggcattggcaagcctagcaaagtgtcggaatgcttt
gttgctcgtgatccatgtgacccacctggtcgccctgaagccattgttattacaagaaac
agtgtcacactgacatggaagaaacctgcctatgatggtggtagcaaaataacaggttat
attgtagaaaagaaagatctacctgatggccgttggatgaaagccagctttaccaatgta
ttagaaactgaattcacagtgagtggacttgtagaagaccaacgatatgaatttagagta
attgcaagaaatgcagctggcaacttcagtgaaccatctgaaagcagtggtgccattact
gcaagagatgaaattgatgcaccaaacgcctcattggatccaaaatatagagacgtcatc
gttgttcacgcaggagagacctttgtccttgaagctgatatccgtggcaaacctatacct
gatgttgtttggttaaaagatggaaaagagcttgaagaaacagctgctaggatggaaatc
aaatccactattcagaaaacaactcttgttgtcaaagactgtatacgtactgatggagga
caatacattctgaaactgagcaatgttggtggtacaaagtctataccaatcactgtaaag
gtacttgacaggcctgggcctcctgaagggcctctcaaagtttctggggttactgctgaa
aaatgttacttggcatggaacccacctttacaagatggtggtgctaatatttcacactac
atcattgaaaagagagagacaagcagactttcctggacccaggtttcaactgaggtacag
gcccttaactacaaagtcactaaacttcttcctggtaatgagtatattttccgtgtcatg
gccgtgaataaatatggcattggagagcccttggaatctgagcctgttatagcctgtaat
ccttataaaccaccaggacctccttcaccacctgaagtctcagcaatcaccaaagattct
atggtagtaacatgggcacgcccagaggatgatggaggtgctgaaattgagggttacatt
cttgaaaaacgagataaagaaggcatcagatggatcaagtgcaacaagaaaacactaaca
gacctccgattgagggtcactggccttaccgaaggtcattcctatgaattcagagttgct
gctgaaaatgcagctggtgtgggtgaacctagtgagccatctgttttctatcgtgcatgt
gatgctttgtatccaccaggtccaccaagtaatccaaaagtgacagacacttccagatcc
tctgtctccctggcatggaataagccaatttacgatggtggtgcacctgttaagggctat
gtcattgaagtcaaagaagccactgctgatgagtggacaacttgcactccaccaacagga
ttacaaggaaggcagttcacagtgacggagcttaaagaaaatactgaatataatttccgt
atttgtgccatcaactctgaaggtgtaggtgaacctgcaactatacctggttcagttgtt
gctcaggatcggctagaaccaccagaaatagaacttgatgctgatctcagaaaggtggtg
attctgcgtgcaagtactactttacgcttatttgtcactatcaaaggtcgacccgaacct
gaagttaaatgggaaaaggctgacgccattctcactgagagggcccagattgaggtgacc
agctcatatacaatgttggtaattgataatgttaccagatttgacagtggtcggtataat
ctgacactagaaaataacagtggctccaaaacagcttttgttaatgtcagagttcttgac
tcaccaagtgccccagtgaatttgactgtaagagaagtgaagaaagactcagtgacattg
tcttgggaaccaccacttattgatggaggagctaagattacaaactacatcattgaaaaa
cgagaagctacaagaaaagcatatgctactgtgacaaacaattgcactaaggtcactttt
aaaatcgaaaatctacaagaaggatgttcttactacttccgagtcttggcttccaatgaa
tatggaattggtttgccagctgaaacaactgaacccatcaaagcttctgaaccacccctc
ccacctgggagagtaactcttgttgatgtgacccgtaacacagctacaattaagtgggaa
aaaccagaaagtgacggtggcagcaaaattactggttatgtagttgaaatgcagactaaa
ggaagtgagaaatggagcacttgcacacaggttaagactctagaagcaactatatctggc
ctaactacaggagaagaatatgtcttcagggtagctgctgttaatgaaaaaggaagaagt
gatccaagacaacttggagtgcccgtaattgcaagggatattgaaatagagccttcagtt
gagcttcctttcaatactttcaatgtaaaggctagagaccaacttaagattgatgttcca
ttcaaaggaagacctcaagctactgtaagctggaaaaaagatggtcagattcttaaagag
acaactagagtcaatatttcttcttcaaagactgtaacatcactgtctattaaggaagct
tcaaaggaagatgttggaacttatgaattatgtgtttcaaacagtgctggatccataaca
gttcctattacagtaatcgtccttgacaaaccagggcctccaggacctatacgtattgat
gaggttagttgtgacaatataactatttcttggaatcctccagaatatgatggtggctgc
caaattagcaattacatcgttgaaaagagagaaaccacttctacaacatggcatgtagtt
tcacaagcagttgcaagaacatccattaaaatagtacgtctgacaacagggagtgagtat
cagttccgtgtttgtgcagaaaaccgctatggaaagagctcctacactgaatcttcagct
gttgttgcagagtatccattcagccccccagggcctcctggtacgcctaaagtagtgcat
gccacaaagtctaccatgattgtcagctggcaaataccagttaatgatggaggaagccaa
gtaattggctatcaccttgagtataaagaaagaagcagcattctttggtcaaaagcaaat
aaaattctcatccccaatactcaaatgaaagtctctggtcttgatgaaggactgatgtat
gagtatcgggtatatgctgtgaatattgctggaattggtaaatgcagtaaggcttgtgaa
ccagtccctgcacgagatccctgtgaccctcctggacaacctgaagtcacaaatatcaca
agaaaatcagtgtcacttaaatggtctaaaccacgttatgatggtggagctaaaatcaca
ggatacattattgaacgtagagaactaccagatggccggtggctgaaatgcaattttact
aacgtacaagaaacatactttgaagtaactgaacttactgaagatcagcgttatgaattc
cgggtttttgcaaggaatgctgctgactcagtcagtgaaccatctgaatccactggacct
attacagttaaagacgatgttgaggctccaagaattatgatggatgtcaagttccgagat
gttattgttgtcaaagctggagaggtccttaaaataaatgcagacattgcagggcgacct
ctaccggtagtttcctgggccaaggatggtgtggaaattgaagaaagggcaagaacagaa
attgtctcaacggactataatactttgttaacagtcaaagactgtgtcagacgagacact
gggcagtacgtactaacactgaagaatgttgcaggaactcgttctatggcagttaattgc
aaggtacttgataagcctggcccaccagcaggaccacttgagataaatggcctcacctct
gagaaatgctctctttcctggggacctccccaagaagatggcggtgcaagtattgactat
tacattgtagaaaaacgtgaaacaagccgccttgcatggacaatatgtgaaggggagtta
aggacaacatcctgtaaaataaccaaattactcaaaggcaatgagtacatctttagagta
acaggtgttaataaatatggtgttggtgagcccctagagagtgtggctgtaaaggcacta
gatccatttacagttccaagtcctcccacatctttggaaattacatctgtgaccaaagag
ttcatgacactttgctggtcgagacctgagagtgatggaggcagtgagatctctggatat
ataattgaaaggcgagagaaaaacggcctacgatgggtgcgtgtaaacaaaaaaccagtt
tatgatttgagagtgaaatcaacaggactccgggaaggatgtgaatatgagtatcgggtt
tttgcagaaaatgctgctggcctaagccttccaagtgaaacctctcccttaattcgggca
gaagatcccgtgttcctaccatctcctccatccaaaccaaaagttgtagactcgggcaag
acaaatataactattagctgggttaagcccctatttgatggtggggccccaataattgga
tacactgtagaatacaaaacatctgatgaaactgactggacaactgccattcagagctta
agaggcacagaatatacaataaatggactaacgacaggagcagaatatgtttttagagta
agatctgtcaataagatgggtgctagtgatcccagtgatagttctgatccccagattgca
aaggaaagagaagaagaacctgtatttgaccttgacactgaaatgaagaagaccttgatt
gtcaaggctggtgcctcattcaccatgactgtgcctttccgaggaagaccggtacccagt
gtctcatggagtaaaccagacactgacctccgcactagagcttatattgattctacagac
tctcgtacatcacttactattgaaaatgccaaccgaaatgattctggaaaatacacatta
acaattcagaatcatttgaatgttgcttcactgaccttagttgtcaaagttttagattct
cctggtcctccagccaatatttctgtacatgatgtcaccaaggagtctgctgtgttatcc
tgggatgttcctgaaaatgatggtggagcacctgtgaagaattaccacatagaaaaacgt
gaggccagtaagaaagcgtgggtctctgtaaccaacaactgtaatcgcctctcctacaaa
gttaccaacttacaagaaggggcgatctactacttcagagtctctggagaaaatgagttt
ggtgttggtgcaccagctgaaacacaggaaggagtaaaaataacagaaaaaccaagccca
cctgaaaaacttggagtaacaagtgtatccaaagatagtgtttccctggcctggttgaag
ccagaacatgatggtggaagcagaattgtacactatatcgttgaagcactagaaaaaggg
cagaaaaattgggttaaatgtgccgtggtgaagtcaacccgtcacgtcgtttctagcctg
agggaaaattctgaatactttttccgggtatttgctgaaaaccaagctggcttgagtgac
ccaagagagcttcttcttcctgttcttgttaaggagcaactagaaccacctgaaattgat
atgaagaatttcccaagtcatactgtatatgttagagctggttcaaaccttaaagttgac
attccaatttctggaaaaccactgcccaaagtgaccttatcaagagatggtgtccccctg
aaagcaaccatgagatttaatactgaagtcactgctgagaacctgaccattaatctcaaa
gaaagtgttgctgctgatgctggaagatatgagatcacagctgccaactccagtggaaca
accaaagcttttattaacatcgtcgtactggacaggcctggtcccccaactggccctatt
gttgttagtgatataactgaagaaagcgtgactctcaaatgggagccacctaagtatgat
ggtggaagtcatgttaccaattacattgtactcaaaagagagacaagtacagcagtatgg
gctgaagtgtcttcaacagttgcaagaaccatgattaaagtcatgaaactgaccaaagga
gaagaataccaattccgcgtcaaggcagaaaaccgctttggcatcagtgatcacatagat
tccgcttgtgtggttgtcaaactaccattcacaacacctggaccaccatctacaccgtgg
gtcactaatgttactcgagaaagcatcaccgtggcctggcatgaaccagtgtccaatgga
ggcaatgcagttataggctatcacctggaaatgaaagacagaaacagtattttatggcaa
aaagtcaacaaaatggttatccgcacaactcacttcaaagtcacaacaatcagtgctgga
cttatttatgaattcagagtgtatgcagaaaacgctgctggtgttggaaaacccagtcac
ccatctgagccagtcctagccatagatgcctgtgaaccaccaagaaatgtccgtatcact
gatatttcaaagaattctgtcaacctttcatggcaacaaccagctttcgatggaggaagc
aagattacaggctatattgttgagagacgagaccttccagatggcaggtggaccaaagcc
agcttcaccaatgtcattgagactcaattcactgtctctggcttgactcagaattcgcag
tatgaattccgtgtctttgctagaaatgctgttggttccgtcagcaatccatctgaggtt
gtgggccccattacatgcatcgattcttatggtggacctgtgattgatttgcctctagaa
tatacagaagttgtcaaatacagagcaggtacatctgtgaagctcagagctggcatttct
ggcaaacctgagcctacaattgagtggtataaagatgataaagaattacaaaccaatgca
ctggtgtgtgtcgaaaataccactgaccttgcatctatactcatcaaagatgcaaatcgc
cttaatagtggaagctatgaattaaaactaaggaatgccatgggctcagcctcagccacc
atcaaagtccagatccttgacaaaccaggacccccaggaggaccaatagaatttaagacc
gttactgctgaaaagataactcttctctggcggcctccaacggatgacggtggtgccaaa
atcactcactacatcgtggaaaagcgtgagacaagccgtgtcgtgtggtctatggtgtct
gaaaatttggaagagtgcatcattacaaccaccaaaattatcaaaggaaatgaatacatc
ttccgggttcgagcagtgaacaaatacggaattggtgattccctggaatctgatccagtg
gtagcaaagaatgcatttgttacaccggggcctccaagcatacccgaggtgacaaaggtt
accaagaattcaatgaccgttgtctggaacagaccagttgcagatggtggtagtgaaata
atcggctatttccttgagaaacgagacaagaaaagtcttggatggtttaaagtcctaaag
gagactatccgtgacaccagacagaaagtgacaggactcacggagaacagtgactatcaa
taccgagtttctgctgtaaatgctgctggacagggtccgttctctgaaccttctgacttc
tacaaagctgctgatcccattgatcctccaggcccaccggctaagataagaatttcagat
tcaactaaatcatccatcactcttggctggagtaaacctgtctatgatggaggcagtgct
gttactggatatgttgtcaagatgagacaaggagaagaagaagaatggactattgtctct
accaaagaagaggtcagaactacagaatatgtggtatctaacctgaaacctggagtcaat
tactacttccaggtatctgctgtaaactgtgctgggcaaggagaacctatagtaatgact
gaacctgtacaagctaaagatatacttgaggaaccagagatcaacctggacgtcgctttc
agaacctctattatagctaaagccggtgaagatgtacaagtatttgttccctttaaaggc
agacctccacctaccgtcacatggagaaaagacgagaagaatcttggcagtgatgccaga
tacagcattcaaagcactgactcgtcctcattactcatgatcccgcaagtgactcgcaat
gatacgggaaagtatattctcacaatagagaatggagttggtgaaccaaagtcttcaact
gtgagtgttaaagtgcttgatacgccagccgcctgccagaaactacagattagacacgtt
tctcaaggcacagtcactctgttctgggatcctcctctcattgatggaggatctcccata
atcaactatgtcattcaaaagagagatgccaccaaaagaacatggtctgcagtgacaaac
aaatgttctagtacatcctttaaggtaacagatttgtcagagaaaactccgttcttcttc
agagttcttgcagaaaatgaaattggaattggggaaccctgtgaaaccacagagcccgtg
aaggctgccgaagtaccagctcctatacgcgatctctcagtgaaagattcaacaaagaca
tctgttaccctgagctggaccaaacctgactttgatggtggtagtgtcatcacagactat
gttgtggaaaggaaaagtagtacagaacaagcatggtcacatgctggcataagtaagacg
tgtgaaattgagattggccaacttaaggaacagtcagttctagaattcagagtatctgcc
aaaaatgagaaaggactgagtgatcctgtcactattgggccagttacagtgaaagaactt
gtaattacacctgaagttgacctgtcagatatccctggggcacaagtcactgtgagaatt
gggcataatgtgcaccttgaattaccttataaaggaaaacccaaaccatctatcagctgg
atgaaagatggtttgccattgaaagaaagtgaaaatgttcgtctcagtaaaactgaaaac
aaaattactctgaatattaagaacgccaagaaggagaatggagggaaatacgccattatt
cttgataacgcagtttgtagaaactcatttcccatcacagtcatcacacttggcccgcca
tcgaagcccaaaggccccattcgatttgatgaaatcaaagcggacagcgtcatcatgtcc
tgggatgtgcctgaagatgacggagggggagaaatcacgtgttacagcattgagaagcgg
gaagcttcacaaactaactggaagatggtgtgctcgagtgttgccaggacgactttcaaa
gttcctaatctagtcaaagattctgaataccaatttagagtgagagccgaaaacagatac
ggagtcagccagccacttgtctcaaccattattgtggcaaaacaccagttcaggattcct
ggccccccaggaaaaccagttgtatacaatgtgacttctgatggcatgtcactaacttgg
gatgctccagtgtataatggtggttcagaagttactgggttccacgttgaaaagaaagaa
agaaatagcatcctctggcaaagagttaatacatcaccaatatctggaagagaatataga
gctactggactaatagaaggcctagattaccaattccgtgtatatgctgaaaattctgcc
ggcctaagctcaccaagtgacccaagcaaatttaccttagctgtttccccagtagaccca
cctggcacgcctgactacattgacgtcacccgagaaaccatcacacttaagtggaaccca
ccgttgcgtgatggaggcagtaagattgtggcctacagcattgagaaacggcaagggagt
gatcgctgggttagatgcaactttactgacgtctgtgaatgtcagtacacagtcacagga
cttagtcctggggatcgatatgagttcagaataattgcaagaaatgctgttggaactata
agtcctccttcacagtcttctggcgttatcatgacaagagacgaaaatgttccaccaaca
gtagagtttggccctgagtactttgatggtctcattattaaagctggacagagtcttaga
attaaagctttggtgcaaggaagaccagtacctcgagtaacttggttcaaagatgaagta
gaaattgaaaagaagatgaatatggaaataactgatgtcctcggatccaccagcctcttt
gttagagatgctactcgggaccatcgtggtgtatatagagtggaagccaaaaatgtatct
ggctctgcaaaagcagaaattaccgtgaaagtacaagatacaccaggaaaagtagttggg
ccaataagattcaccaatattactggcgagaagatgaccctgtggtgggatgctccgctc
aatgatggctgtgctcccgtcactcactacattgttgaaaaacgggaaaccagcagactt
gcttgggcactaattgaggataaatgtgaagctcacagctacactgccactaaactaata
actggcaatgaatatcaattccgtgtttctgcagttaacaagtttggtgttggcaggcca
ctggattctgacccagtggttgctcaaatacaatacactgttcctgatgcccctggcact
ccagaacaaagtaacgtaacaggcaatagcattaccgtgacatggacaaggccagaatca
gatggtggcaatgaaattcaacactatatccttgaaaggagagaaaagaaaagcacacga
tgggtaaaagtgatcagcaaacgaccaatctctgagacaagattcaaagtcactggtctg
atagaggggaatgagtatgaattccgtgtcatggctgaaaatgctgcaggagtaggacct
gccagtgatatctcaagactaatcaaatgtagagagccagtcagcccaccaagtgctccc
tctgtggtcaaagtgacagacacatcaaagacaactgtgagcttagaatggtctaagcca
gtgtttgatggaggcatggaaataattgggtatattattgaaatgtgcaaagctgactta
gaagactggcacaaggtgaacgcagaggcatgtgtgaaaacaagatacacagtcacggat
ctacaagcaggggaagaatacagattccgggttagtgccatcaatggcgctgggaaagga
gagagctgtgaagtgactggcacaattaaagcagttgaccgattaacagctcctgagtta
gacattgatgcaaacttcaagcagactcatgttgttagagctggggccagcatccgcctc
ttcattgcctaccagggtagaccggctcctacagctgtgtggagcaaaccagactctaac
cttagcatccgggctgatatccatacaacagactccttcagcaccctcaccgtggaaaac
tgcaacagaaatgacgcagggaaatatacccttaccgtggaaaacagcagtggtagtaag
tcaatcacattcacagtcaaggtgctagacacgccagggccacctggcccgattaccttc
aaggatgtgacccggggatctgttacactgatgtgggatgcccctctccttgatggtggt
gcccgaatccatcactatgtggtagagaaacgagaagcaagtcgccgtagctggcaggtt
gtcagtgaaaaatgcactcgtcagatcctcaaggtcaatgacctggcagaaggcgttcca
tattatttccgtgtttctgcagaaaatgagtatggtgttggtgaatactatgaaatgcca
gaaccaattatagccacagaacagcctgctccacctaagagacttgatatcgttgacaca
agcaaatcctctgcagtcttagcttggcttaaaccagaccatgatggaggcagccggatc
actggctacctgctcgaaatgagacaaaagggatctgacttctgggttgaagctggtcac
accaaacagctgactttcacagtggaaagcctagttgagaacactgaatatgaattccgt
gtgaaggccaagaatgatgctggctacagtgaacccagggaagccttttcttctgttatt
atcaaggagcctcaaattgagcccactgctgaccttactggaattaccaatcagctcata
acttgcaaagcaggaagcacatttaccattgatgtgccaatcagtggtcgtcccaccccc
aaagtaacatggaagctagaagaaatgagacttaaggagacagatcgaatgagtatcaca
acaacaaaagacagaaccaccttgtctgtaaaagaaagcatgagaggtgactctggaaga
tacttcttgaccctggaaaatacagctggagttaaaacatttaccatcacagttgtggtc
atcggaagaccaggtccagtaaccggccccatcgaagtctcatccgtctcagccgaatca
tgtgtcctttcatgggctgaacctaaagatgatggaggcaccgagattactaattatata
gttgaaaagcgagagtcgggtacaacagcttggcagcttataaattccagtgtcaagcgc
actcagattaaagtcactcatctcacaaaatacatggaatattctttccgtgtcagttca
gagaacagatttggtgtcagcaagcctcttgaatcagcaccaataattgctgagcatcca
tttgttccaccaagtgctcctaccagacctgaagtctaccacgtgtcagccaatgccatg
tctattcgttgggaagaaccctatcacgatggtggcagcaaaatcattggctactgggtt
gagaagaaagaacgcaacaccattctttgggtgaaagagaacaaagtgccatgcttagag
tgcaactacaaagtgaccaatttggtagaaggactggaatatcagttcagaacatatgcg
ctcaatgccgcaggtgttagcaaagccagtgaagcttcacgacctatgatggcacaaaac
ccagttgatgcaccaggaagaccagaggtgacagatgtcacaagatctacagtgtcactg
atttggtctgccccaatatatgatggaggcagcaaggttgtgggctacatcatagagcgt
aagccagtcagtgaagttggcgatggtcgctggctgaagtgcaactataccattgtatct
gacaacttcttcactgtgactgctctcagtgaaggagacacttatgaattccgtgtgttg
gccaagaatgccgcaggcgtaattagcaaaggatcagaatctacaggccccgtcacttgc
cgagatgaatatgctccacccaaggctgaactggatgccagattgcagggtgatctggtt
accatcagagcaggctcagatcttgttctggatgccgctgttggtggcaaacctgaaccc
aaaatcatctggaccaagggggacaaggaactagacctctgtgaaaaagtctctttgcag
tacactggcaaacgagcaactgctgttatcaaattctgtgacagaagcgacagtggaaaa
tataccttaacagtgaagaatgccggtgggaccaaggccgtgtctgtcttggtcaaagtt
cttgatacccctggcccatgtggaaatctcaccgtgagcagggtgacggaggagaagtgc
acgttagcctggagccttcctccagaggatggaggagcagcaataactcactacattgtg
gaaaggcgcgagaccagcaggctcaactgggtgattgttgagagcgaatgcccaacccta
tcctacgtcgttactagactcatcaagaacaatgaatacatattccgagtgcgggcagta
aacaaatatggccctggtgtacctgccgaaacacagccaattatagccagaaactcattc
actattccatcacaacccggcatacctgaaagagttggggctggcaaagagcatatcatt
attcagtggctaaaacccgaatctgatggtggcaatgagatcagcaactacctagtggac
aaacgtgagaagaagagcttgcgttggacgcgtgtcaacaaagactatgtggtgtatgat
accaggctgaaggtgactggcctgatggaaggctgcgattaccagttccgggtgaccgca
gtgaatgctgctggtaacagtgaacccagcgaggcttccaactttatctcctgcagagaa
ccatcatatacccctggaccaccttctgctcccagagttgtagataccacgaagcacagc
attagtttggcatggaccaagcccatgtacgatggaggcactgacatcataggatatgtt
cttgagatgcaagagaaggacactgatcagtggtaccgcgcgcacaccaacgccacaata
cgaaatactgagttcacggtggtagaccttaaaatgggtcagaaatactccttcagagtc
gctgctgtgaatgtgatggggatgagtgaatacagcgaatcagttgctgaaattgagcct
gtggaaagaatagaaataccagatcttgagcttgcagatgacttaaagaagactgtgacc
atcagagctggggcctcattacgcctgatggtgtctgtatctggaaggccacctcctgtc
ataacatggagcaagaagggcattgaccttgtaaaccgggcaatcattgacaccactgag
agctactctttgcttattgtggacaaagttaaccggtacgatgctggaaaatacaccatt
gaagccgaaaatcaatctggcaagaaatcagcaacagtccttgttaaagtatacgatact
cccggtccctgtccttcagtgacagttaaggaggtatcaagagattctgtgaccattacc
tgggaaatccctacaattgatggtggagctccagtcaacaactacattattgagaagcgt
gaagctgccatgagagcatttaaaacggtaactaccaaatgcagcaagacactttaccgg
atttctggacttgtagagggaaccatgtactatttcagagtgttaccagaaaacatttac
ggcattggagagccttgtgaaacatctgatgcagttctggtctcagaagtgcctttggtg
cctacgaaactggaagtagtcgatgtcaccaaatcaactgttacccttgcctgggaaaaa
ccactctatgatggtggtagccgactcactggatatgttcttgaagcctgcaaagctgac
actgacagatggatgaaggttgttaccttaaaatccacagtcctagagcacactgttgtt
tccctaaatgaaggtgaacagtacttatttagagtaagggcacagaatgagaaaggtgtg
tcagaaccaagagagatcatcacacccgtgactgtacaagacctcagagtgttgccaaca
attgatctttctacgatgcctcaaaagaccatccatgtcccagctggccggccagtagag
ctggtgatacccatcgctggtcgtccacctcctgctgcttcatggttcttttctggttct
aaactaaaagaatcagagcgtgtcacagttgaaactcataccaaagtagcaaaattaacc
atccgtgaaaccacaatcagagatactggagaatatacacttgaattgaaaaatgtaact
ggaactacttcagagaccattaaagttatcattctcgacaagcctggtccaccaactggg
cctatcaaagtcgatgaaattgatgctacttcagtcaccatttcctgggaagcacctgaa
ttggatggtggggcccctttgagtggttatgtggtagaacaacgtgacgcccatcgtcca
ggatggctgccagtgtctgaatcagtgactagaacgacatttaagtttaccagactcatt
gaaggaaatgagtatgtgttccgtgtggctgcaacaaaccgcttcgggattggctcttac
ctgcagtctgaggtcatagaatgtcgcagcagcatcagtattcctggacctccagaaaca
ttagagatatttgatgtctcccgtgatggcatgacacttacttggtatccaccagaagag
gatggtggctcccaagtgaccggatacattgtggagcgcaaagaagtgagagcagaacga
tgggtccgtgtaaataaagtaccagtgacaatgacacggtaccgttccactggccttatt
gaaggcttagagtatgaacaccgtgtcacagccattaatatgagagggaccggaaaacca
agtcgtccttccaaacccatcgttgccatggatccaattgctcctccaggaaagccgcaa
aaccctagagttactgatacaacaaggacatcggtttccctggcctggagtgctccagaa
gatgaaggaggatctaaagtcaccggctacttgattgaaatgcaaaaagtagatcaacat
gaatggaccaaatgtaacaccaccccaaccaagatccgggaatatactctaactcaccta
cctcagggcgcggaatacagattccgtgtcctagcttgtaacgctggtggacctggggag
cctgctgaggtaccaggaactgtcaaaatcaccgaaatgcttgaacatcctgatattgaa
cttgatgaaaaataccaggagggtgtccttgtaagacaaggtggagtcatcagacttacc
attccaatcaaaggaaaaccatacccaatatgtaaatggaccaaagaaggccaagatatt
agtaagcgtgccatgattgcaacctctgaaacacataccgagcttgtcatcaaagaagca
gtcagggatgattctggcacttacgacctggttctggaaaacaaatgtggcaagaaggcc
gtttacatcaaagtcagggtgataggaattcctaacactcctgaagggccacttgaatat
gatgacatacaagctcgctctgtaagggtcagctggagacccccagctgatgatggtggc
gctgacatcttaggctacatccttgagagacgagaagtgcctaaagccgcctggtatacc
attgattccagagtccgaggtacatctctggtggtcaaaggcctcaaagaaaatgtggaa
taccatttccgtgtttcagcagaaaaccagtttggcataagtaaacccttgaagtctgag
gaaccagtcataccaaaaacaccactaaatcctccagagcctccaagcaatcctccagaa
gtacttgatgtgaccaagagttctgtcagcctgtcctggtcccggcccaaagacgacggt
ggttctcgagttacgggctactacatcgaacgcaaggagacatcaactgacaagtgggtc
aggcacaataagactcagataacgactacaatgtacactgtcacagggctcgttcctgat
gctgaatatcagttccgtgtcatcgcacagaatgatgttggcctaagtgagaccagtcct
gcttctgaaccagttatttgcaaagatccatttgataagccaagccaacctggagaactt
gagattctttcaatatccaaagatagtgtcactctacagtgggagaaacctgaatgtgat
ggtggcaaggaaatccttggatactgggttgaatatagacaatccggagacagtgcctgg
aagaagagcaataaggaccacatcaaggacaggcaattcacaataggggggttgctggaa
gctaccgaatatgaattcagggtttttgctgaaaatgaggctgggcttagcagacctcga
agaactgctatgtctgtaaagacgaaactaacatctggagaagccccaggagtacgcaaa
gaaatggaggatgttaccaccaaattgggtgaagctgctcaactctcatgccagatcatt
gggaggcctctccctgacattaagtggtaccgatttggtaaggagctcgtacaaagccgg
aagtacaaaatgtcttcagatgggcgcacgcacaccctgacagtaatgacagaggaacaa
gaagatgaaggtgtttatacctgcatagctactaatgaggttggagaggtagaaaccagt
agtaagcttctcctgcaagcaacaccacagttccatcccggttacccactgaaagagaaa
tattacggtgctgtgggttcgacacttcgacttcatgttatgtacattggtcgtccagta
cctgccatcacctggttccgtggccagaaacttgtacaaaactcagaaaacaccactatt
gaaaacaccgagcactatactcatctcgtcatgaagaatgtccagcgtaagactcatgcc
gggaaatacaaagttcagctcagcaatgtttttggaacagttgatgccatccttgatgtg
gaaatacaagataaaccagacaaacctacaggacccattgtgattgaagctctattaaag
aactctgtagtgattagctggaagccaccggaagatgatggaggctcctggatcaccaat
tacgtggtggagaaatgtgaggccaaggaaggggctgaatggcaattggtgtcttcagcc
atctcagtgacaacctgtagaattgtgaacctcacagaaaatgctggctactacttccgt
gtttcggctcagaacacttttggcatcagtgaccctctggaggtcccctcagttgtgatc
attaagagtccatttgaaaagccaagtgctcctggcaagccaactattactgctatcacg
aaagagtcttgtgttgtggcttggaagccacctgccagtgatggtggtgcaaagattaga
aattactaccttgagaagcgtgagaagaagcagaataaatggattgcagtgacaacagaa
gaaattcgagaaactgtcttctcagtgcaaaaccttattgaaggtcttgaatatgagttc
cgcgtgaagtgtgaaaacctaggtggggaaagcgaatggagtgaaatatcagaacctgtc
actcccatatccgatgtcccaatccaggcaccacactttaaagaggaactaagaaatcta
aacgtcagatatcagagcaatgctactttggtctgcaaagtgactggccatccaaaacct
attgtgaaatggtacagacaaggcaaagaaatcatcgcagatggattaaagtacagggtt
caggagtttaagggtggctaccaccagctcgttattgcaactgtcacggatgacgatgcc
acagtttaccaagtcagagctaccaaccaagggggatctgtatctggcactgcctccttg
gaagtggaagttccagctaagatacacttgcctaaaactcttgaaggcatgggagccgtt
catgctctccgaggcgaagtgatcagcatcaagatccctttcagcggtaaaccagatcct
gtgatcacctggcagaaaggacaagatctcatcgacaataatggccactaccaagttatt
gtcacacgatctttcacctcccttgttttccccaacggagtggagagaaaagatgctggt
ttctatgtggtctgtgctaaaaacaggtttgggattgatcagaagacagttgaactggat
gtggctgatgttcctgatccacccagaggagtcaaagttagtgaggtctcacgagattct
gtcaatttaacctggactgagccagcttctgatggtggcagcaaaatcaccaactacatt
gttgaaaaatgtgcaactactgcagaaagatggctccgtgtaggacaggcccgagaaaca
cgttataccgtgatcaacttatttggaaaaacaagttaccagttccgtgtaatagctgaa
aataaatttggcctgagcaagccttctgagccttcggaaccaaccgtaaccaaagaagat
aagaccagagctatgaactatgatgaagaggtagatgaaaccatggaagtttccatgact
aaagcatctcactcttcaaccaaggaactctatgagaaatacatgattgctgaagacctt
gggcgtggtcagtttggaatcgtccaccgttgtgttgaaacatcctcaaaaaagacatac
atggctaaatttgtgaaagtcaaagggactgatcaggttctggtaaagaaggaaatttcc
attctaaatatcgctaggcacagaaacatcttatacctccatgaatcatttgaaagcatg
gaagaattggttatgatctttgagttcatatcaggacttgacatattcgaacgcattaac
acaagtgcttttgaacttaatgaaagagaaattgtaagttatgttcgccaggtctgcgaa
gctcttgagttcttacatagtcagagtattggacactttgacattagaccagaaaacatc
atttaccaaacaagacggagctccatcattaaaatcatagaatttggtcaagctcgtcag
ctgaagccaggggacaactttaggcttctgttcacggcccctgaatactatgcacctgaa
gtccaccagcatgatgttgtcagcacagccacagacatgtggtcactcggaacactggtg
tatgtgctgttgagtggtatcaatccattcctggctgaaaccaaccaacagatgattgag
aacatccggaatgctgaatatacttttgatgaggaggcattcaaagagatcagcctggaa
gccatggattttgttgaccggctgttagtgaaagagagaaaatctcgcatgacagcatct
gaagcactccagcacccatggctgaagcagaagacagaaagagtcagcactaaagttatc
agaacattaaaacaccgacgttactaccacactctgatcaagaaagacctcaacatggtt
gtgtctgcagccaggatctcctgtggtggtgcaattcgatctcagaagggagtgagcgtt
gctaaagttaaagtggcatccattgaaattggcccgatttctgggcagataatgcatgca
gttagcgaagaaggagggcatgtcaaatacatctgcaaaattgaaaattatgaccagtct
acccaagtgacctggtactttggtgtcagacagctggagaacagcgagaaatatgaaatc
acctatgaagatggaatggccaccatgtacattaaggacattaccaaattcgatgatggt
acctacagatgcaaagtagtcaatgactatggtgaagacagttcctatgcagagctgttt
gttaaaggagtgagagaagtttatgactattactgccgtagaaccatgaagaagatgaag
cgcagaacagatgccatgagactcctggaaaggccaccagaatttaccctgcctctcttt
aacaagacagcttatgtgggcgaaaacgtccggtttggagtaaccataactgtccaccca
gagcctcgtgtaacatggtataagtcaggccagaaaatcaaaccaggtgatgatgataag
aagtacacatttgagtctgacaagggtctttatcaattaacaatcaacagtgtaacaaca
gatgatgatgccgaatatgctattgtggccagaaacaaatacggtgaggacagctgtaaa
gcaaagctgaccgtgaccccacacccacctccagcagacacaaccttaagacccatgttc
aaaaggctactggccaatgcagaatgccaggaaggccaaagtgtcagctttgagatccga
gtttctggaatccccccgccaactttaaaatgggaaaaagatggtcagccactgtccctc
gggcctaacattgaaattatccatgaaggcttggattattatgctttgcacatccgggat
actttgcccgaggacactggttattatagggtcacagccacaaacacagctggatccacc
agctgccaggcgcacctaaaagtggaacgcttgaggtacgtcaaacaggaattcaagagc
aaagaggagcgtgaacgacacgtacaaaagcaaattgacaagacactaagaatggctgaa
attctttccggaaaggaaagtgtgccactgacccaggtagcccaagaggccctgagagaa
gctgccatcctctacaagccagctgtgagcaccaagaccgtgaagggcgagttccgcctt
gagacagaggagaggcagcaggagaggaagctccggatgccttacgaagtgccagagccc
cgcaagcacaagcagcccgccacggaggaagaccagcgcattaagcagtttgtgcctatg
tctgacatgaaatggtacaaaaagatacgcgatcaatttgaaatgcctgggaaaattgac
agagttgtacagaaacgacaaaagcgcatccgcctttcgagatgggaacagttctacgtg
acgcctctcccgcgcttcacggatcaatacaggcccaagtggcgcatccccaagctgacc
caggatgacctggaaatggtgaggccggcccgccggcggacgccttctcccgattatgcc
ttctactacagacctaggaggcgttcccttggtgacatctccgatgaagagctgctcctt
cccatcgacgactacttggcgatgaagagaacggaggaagagaggctgcgtcttgaagag
gagcttgagttaggcttctcggcttcgcccccgagccggagccctccacgcttcgagctt
tccagcctgcggtactcgtccccgcaagcccacgtcaaggtggaggagacaaggaaagac
ttcaggtattcaacctaccacatccccaccaaggccgagacgagcacgagctacgcagaa
ctgcgggagcggcacgcgcaggccgcccacaggccccccaaacagcggcagcgcatcctg
gcggcccgggaggacgaggagctgcttcggccacttgcagccacccagcggctgtccgaa
tacaaaagcgagctggaccgcatgtcaaaggaacagaagtctaggaagaaatcaaagcaa
cagagacaagtaacggaaataacagaaatcgaggaagaatacgaaatcacaaagcgtgct
cagagagagtcatcctcgtctgtgtctagactgctgaggcgacggcgctccctgtcccca
acttacattgagttaatgaggccggtggccgagctgatccggacgcgcccgccgccagct
gaggaatcagaagatgacacggaaagaaggtctcccactccagagagaactcgcccacgt
tcccccagccccgtctccagtgagaggtcactctcaaggtttgagaggtcggcaaggttt
gacatcttttccaggtatgagtccatgaaagctgctttaaagactcagaggacgtcggaa
aggaagtatgaagtgttgactcagcagcccttcacgctggaccatgccccgcgaatcacg
ctgagaatgcgatcccacagggtgccctgcggccagaatacgcggtttatcttaaacgtt
caatctaagccaactgccgaggtgaaatggtaccacaatggtgtggagctccaggagagc
agcaagatccactacaccaacacgagtggggtcctgagcctggaaattctggactgtcac
attgacgacagcgggacgtaccgcgccgtgtgcaccaactacaagggcgaagcttcggac
tatgcgaccttggacgtaacaggaggggactacaccacctacgcttcccggcgcagagac
gaggatgccccccggtccattttccctgacctgacaagaacagaggcatatgcagtgtca
tcgttcaagaaaacgtccgagatggaagctgcttcctcagtcagggaaatgaaatcacag
atgacagagacaagggaaagtctctcatcatatgaacaccacgcatctgcagaaatgaaa
agggctgcagtagaagaaaagctgctggaagaaaaatccacacacagaaagatcaagtcc
actttggcagcaagaatcctaaccaagccaaggtccataactgtctctgagggagagtct
gcaaggttttcttgtgacacagatggtgagccggtaccaaccgtgacctggctgcgtgga
gggcaagtaatcagcacttccacccgccaccaagtgaccaccacgaaatacaaatcgacc
tttgagatctcttcggtccaggcttctgatgagggcaactacagcgtggtggtagaaaac
agtgaagggaggcaagaagcacagtttactctcactattcaaaagtccagggttactgaa
aaggctgtgacatcgccaccgaaggtcaaatccccagagcctcaggtgaaatccccagaa
ggagttaagtctccaaaacgagtgaaatctccagaactggtgacttctcccccaaaagcc
gtgtcacccacagagacaaaacccccggcaacagagaaagttgggcagctaccagtccct
gccccgcccaagataactcagtccctgaaagcagaagctgttaaagatattgccaagttg
acctgtgctgtcgaaagtagtgtattatgtgcaaaagaggtcacctggtataaagatggc
aagaaactgaaggagaatgggcatttccagtttcattattcagcagacggcacctatgag
ctcaaaatccataacctcactgaatccgattgtggagaatacatttgtgagatttctggt
gaaggcggaacttccaaaactaagttacagtttatgggacaagcctttaagagcatccac
gagcaggtgtcaagcatagcagaaactaagaaatcaactcagaaaactgctgagtcaaca
gaaaccaaggtatcagctcagaaaagtgctgagtcaacagaagccaaggtatcggctcag
aaaacggctgagttaaccgaaaccaaggtatcagctcagaaaactgagttaacagaaacc
aaggtatccgctcagaaaactgctgagtccacagaaaccaagatatcagctcagaaaact
gctgagtccacagaaaccaagatatcagctcagaaaactgctgagtccacagaaaccaag
atagccgctcagaaaacggctgagtccacagaaaccaagaaaactgaaacaaaagctcct
gagccaatatcctcaaagccagtaattgttactgggctgcaggatacaactgtttcttca
gacagcattgctaagttttcaattaaagctactggagaaccccagccaactgtcatctgg
acaaaggatggaaaggctattgcacaagggggtaaatataaactttctgaagacaaagga
ggattcttcttagaaattcataaaaccgacacttccgacagcgggctttacacttgtaca
gtaacgaactcagctggatctgtgtcctctagctgcaaattaaccataaaagctgtaaaa
gacactgagatgcagaaagtatctacagaaaagacttccgaaattacatcccaaaagaag
gcagttgtccaagaggaaatttcccaaaaagccttaatttctgaagaaatcacgaagtca
gaggtgaaatctcaagaaaagctagccctcgtggaggaagcttcgaaggttacgatttct
gaaaaggtcaagaagtcagaagcagcctccctggaaaaatccattgtccatgaggaagtc
acgaaaacatcacaggaaatcagcactcaagctgaaatcaaagccttttctagtcagatg
agcataactgacggtcagaaagtgactttaaaagccaacattgccggcgccaccgatgtg
aaatgggtcctcaatggagcggagctcacgaactccgaggagtacaggtacggcgtctcg
ggcggcgagcagaccctgaccatcaggcgggccggccgcgagcatgaaggcgtcctcacc
tgcatcggcaaaaccagccaaggcatcgtcaagtgtcagtatgacttgagcctgagccaa
gagctctcaggggctccggccttcatctcacagcccagatctcagaacgttaacgaagga
caaagtgtcctattctcttgtgaaatcagtggtgagccctcccctgaaatcgagtggttt
aaaaacaacctgccgatttctgtttcttccaacatcagtgtaagtcgctccagaaatgca
tattctcttgaaatccgaaacgcatcagtgagcgacagtgggaagtacacgattaaggcc
aaaaacttccgtggccagtgttcagccactgcttccttaaccgtccttcctctagttgaa
gaacctcccagagaggtagtattgaagacaagtggtgacacgagcttgcaaggaagcttc
tcgtctcagtcagtccaaatgtctgcgtctaagcaggaggcctccttcagcagtttcagc
agcagcagtgctagcagcatgactgaaatgaaatttgctagcatgtctgcccaaagcatg
tcctccatgcaagagtcctttgtaggaatgagttccagcagttttatgggaaaatctagt
atgacacaactggcaagctcgactagtagaatgcttacagcaggcgtaagaggaattcca
cctaaaattgaagctctcccctctgacatcagcatcgatgagggcaaagttttaacagta
gcctgcgcttttaccggcgagccggccccagaaataacatggtcatgtggtggaagagag
atccacagtgaagaacaggggagattccgcattgaaaacacagaggacctgaccaccctg
atcatcatggacgtacagaaacaggacggtgggctttataccctgagcttagggaatgaa
tttggatctgactctgctactgtgaatataaacattcgatccatttaa

DBGET integrated database retrieval system