KEGG   Miniopterus natalensis (Natal long-fingered bat): 107536340
Entry
107536340         CDS       T05883                                 
Symbol
RRBP1
Name
(RefSeq) ribosome-binding protein 1
  KO
K14000  ribosome-binding protein 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107536340 (RRBP1)
SSDB
Motif
Pfam: Rib_recp_KP_reg ABC_export
Other DBs
NCBI-GeneID: 107536340
NCBI-ProteinID: XP_016067480
LinkDB
Position
Unknown
AA seq 974 aa
MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTYHQKVEKK
KKEKTVEKKGKTKKKDEKPNGKIPDHEPAPQMTVLLKDPGRPPAVAVAPTSVHPPVVIFP
IATVPAMPQEKLASSPKDKKKKEKKVAKVEPAVSSVVNSVQVLASKAAILETAPKEGKNA
DMLQSQEAPKQEAPAKKKSGSKKKGEPGPLDTDSPLYLPYKTLVSTVGSMVFSEGEAQRL
IEILSEKAGIIQDTWHKATQKGDPVAILKRQLEEKEKLLATEQEDAAAAKSKLRELNKEF
TAEKAKAAAGEAKVKKQLVAKEQEITAMQARMQASYQGHVKEVQQLQGKIRTLQEQLENG
PNTQLARLQQENSILRDALNQATSQVESKQNAELAKLRQELSKVSKELAEKSEAARQEDQ
QRKVLESKAAALEKQILQLQASHKESEEALQKRLDEVSRELCRAQTSHASLRADAEKAQE
QQQQLAELHSKLQSSEAEVKSKCKELSGLHGQLKESRAENSQLTERIRSIEALLEAGQAR
DAQDAQASQVEANQQQARLEELESQVRCLEKEAAELQEAVEQQKGRNNDLREKNWKAMEA
LASAERASEEKLRSLTQAKEESEKQLSLMEAQTKEALLALFPALPNSAHQNYTEWLQELK
EKGPELLKQLPVNTETPLDLASKLREAEETQSSLQAECDQYRTILAETEGMLRHLQKSVE
EEEQVWKAKVGAAEDELQKSRVTVRHLEEIIEKLKGELESSDQVREHTSLLEAELEKHMA
AASADCQSYAKEVAGLRQLLLESQSQLDSAKSEAQKQSNELALVRQQLSEMKSHVEDGDV
AGSPAAPPAEQDPVELKTQLERTEAILEDEQTQRQKLTAEFEEAQNAACRLQEELEKLRA
SPLESTEAEAVTQLKERLEKEKKLTSDLGRAATKLQELLKTTQEQLAKEKDTVKKLQEQL
EKTDGSSSKEGTSV
NT seq 2925 nt   +upstreamnt  +downstreamnt
atggacatttacgacactcaaaccctgggcgttgtggtctttggtggattcatggtggtg
tccgccattggcattttcctggtgtcgaccttctccatgaaggagacgtcctatgaagaa
gctctagccaaccagcgcaaggagatggcaaaaacttatcatcagaaagtagaaaagaaa
aagaaggagaaaacggtggagaagaaaggaaagaccaagaaaaaagatgagaaacccaac
gggaagatccctgaccacgagccagcccctcaaatgaccgtcctcctcaaagacccaggg
cggccacctgcagtggctgtggctccaacttcagtccatccccctgtggtcattttccct
atagccacggtgccagccatgccccaagagaagctggcctcttcccctaaggacaaaaag
aagaaagagaaaaaagtagcaaaagtggaaccagcagtcagttctgtggtgaattctgtc
caggttcttgcctcaaaggctgccatcttggaaaccgctccaaaggagggcaaaaatgca
gatatgcttcagagccaggaggcaccaaagcaagaggctcctgcaaagaagaagtctggt
tcaaagaagaaaggcgagcctgggcccctggacaccgacagtcctctctacctcccctac
aaaacgctggtctccacagtcggaagcatggtcttcagcgagggtgaggcccagcggctg
attgagatcctgtctgagaaagctggcatcattcaggacacctggcataaggccacgcag
aagggtgaccctgtggcgattctgaaacgccagctggaagagaaggaaaagctgctggcc
acagagcaggaagatgcggctgctgccaagagcaaactgagggaacttaataaggagttc
acagcagaaaaggccaaggcagcagccggggaggccaaggtgaaaaagcagctggtggcc
aaggagcaggagatcacagccatgcaggcccgaatgcaggctagctaccaggggcacgtg
aaggaggtgcaacagctgcagggcaagatccggactcttcaggagcagctggagaatggc
cccaacacacagctggcccgcctacagcaggagaactctatcctgagggatgccttgaac
caagccacgagccaggtggagagcaagcagaatgcagagttggccaagctccggcaggag
ctcagcaaggtcagcaaggagctggcagagaagtcggaggcagcacgacaagaggaccag
cagcggaaggttctggagtccaaagcagctgcattagagaagcagatcctgcagttgcaa
gcgtctcacaaggagagtgaggaggccctgcagaaacgcctggatgaggtcagccgggag
ctctgccgcgctcagaccagccacgccagccttcgggcagacgccgagaaggctcaggag
cagcagcagcagctggccgagctgcacagcaaattacagtcgtccgaggcggaggtgaag
agcaagtgcaaggagctgagtggtctacacgggcagctcaaggagtccagggcggaaaat
tcccagctcacagagagaatccggtccatcgaagccctgttggaggcagggcaggcccgg
gacgcccaggatgcccaggccagccaagtggaggccaaccagcagcaggcacgccttgag
gaattggagtcccaggtgcggtgtctggaaaaggaggccgccgagctccaggaggctgtt
gagcagcagaaagggaggaacaatgatctccgagaaaagaactggaaggcaatggaggca
ctggcctcagccgagagagcctccgaggagaagctgcgctccctgacccaggccaaggag
gaatccgagaagcagctcagcctgatggaggcacagaccaaggaggctctgctggctctg
ttcccagcacttcccaattcagcccaccagaattacactgagtggctccaagaactcaaa
gagaaaggcccggaactgctgaagcagctgccagtgaacacagagacacccttggacctg
gcctccaagctgagggaggccgaggagacccagagcagcctgcaggccgagtgtgaccag
tatcgcaccattctggcagagacagagggcatgctcaggcacctgcagaagagcgtggag
gaggaggagcaggtgtggaaggccaaggtcggcgccgcagaggacgagctccagaagtca
cgggtcacagtgagacatctcgaagagattatagagaagctaaaaggagaacttgaaagt
tcagatcaggtgagggagcacacctcgcttctggaggcagagctggagaagcacatggca
gccgctagtgccgattgccagagctacgccaaggaggtggcggggctgaggcaactttta
ttagaatctcaatctcagctggattcagccaagagcgaagcccagaaacagagcaatgag
cttgccctggtcaggcagcagttgagtgagatgaagagccacgtagaggatggtgacgta
gctgggtctccggctgctcccccagcagagcaggaccctgtcgagctgaaaacgcagttg
gagcggacagaagccatcctggaggatgaacagacgcagcggcagaagctcacggctgaa
tttgaggaggctcagaacgcggcatgtcggctgcaggaggaattggagaagctccgtgcc
agccccctcgagtctacagaagcagaggcagtcacacagctgaaggagagactagaaaaa
gagaagaagttaacgagtgacctgggccgtgctgccaccaaattacaggagcttctgaag
acgacccaggagcagctggcgaaagagaaagacacagtgaagaagttacaggagcagctg
gagaaaacagatggtagcagctcaaaggagggcacctctgtctga

DBGET integrated database retrieval system