KEGG   Miniopterus natalensis: 107537584
Entry
107537584         CDS       T05883                                 

Gene name
SGCD
Definition
(RefSeq) delta-sarcoglycan
  KO
K12563  delta-sarcoglycan
Organism
mna  Miniopterus natalensis
Pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107537584 (SGCD)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107537584 (SGCD)
   05414 Dilated cardiomyopathy
    107537584 (SGCD)
   05416 Viral myocarditis
    107537584 (SGCD)
SSDB
Motif
Pfam: Sarcoglycan_1 DUF2345
Other DBs
NCBI-GeneID: 107537584
NCBI-ProteinID: XP_016069114
LinkDB
Position
Unknown
AA seq 289 aa
MPQEQYAHHRGAMPGSEGPQVYKVGIYGWRKRCLYFFVLLLMILILVNLAMTIWILKVMN
FTIDGMGNLRITEKGLKLEGDSEFLQPLYAKEIQSRPGNALYFKSARNVTVNILNDQTKV
LTQLITGPKAVEVYGQRFEVKTVSGKLLFSADNSEVVVGAERLRVLGAEGTVFPKSIETP
NVRADPFKELRLESPTRSLVMEAPKGVEINAEAGNLEATCRTELRLESKDGEIKLDAAKI
KLPRLPHGSYTPAGTRQKVFELCVCANGRLFLSQAGTGSTCQINTSVCL
NT seq 870 nt   +upstreamnt  +downstreamnt
atgcctcaggagcagtacgcacaccaccggggcgccatgcccggctccgaggggccgcag
gtgtacaaggtgggcatctacggctggcggaaaagatgcctgtacttcttcgtcctgctg
ctgatgattttaatactggtgaacttggccatgaccatctggattctcaaagtcatgaac
ttcacaatcgatggaatgggaaacttgagaatcacagaaaaaggtctaaagctggaagga
gactcagaattcttgcaacctctctacgccaaagaaatccagtcccgcccgggtaatgcc
ctgtacttcaaatcagccagaaacgtgacagtgaacattctcaatgaccagactaaagtg
ctcactcagctaataacaggtccaaaggccgtagaagtatatggccaaaggtttgaagta
aagacagtttctggaaagttgctcttctctgcagataacagtgaagtggtagtcggagct
gagagattgcgagttttaggagcagagggcacagtgttccctaaatctatagagacacct
aatgtcagggcagaccccttcaaggaactaaggttggagtccccaacccggtctctggtg
atggaggccccaaaaggagtagaaataaatgcagaagccggcaatctggaagccacctgc
agaacagagctgagactggagtccaaagacggagagattaagttagatgctgcgaaaatc
aaactacctagactgcctcacggatcctacacgcccgcggggacgaggcagaaggtcttc
gagctctgcgtctgcgccaatgggagattattcctgtcccaggcaggcaccggctccact
tgtcagataaacacaagtgtctgcctctga

DBGET integrated database retrieval system