KEGG   Miniopterus natalensis: 107538150
Entry
107538150         CDS       T05883                                 

Gene name
IL33
Definition
(RefSeq) interleukin-33 isoform X1
  KO
K12967  interleukin 33
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04217  Necroptosis
mna04623  Cytosolic DNA-sensing pathway
mna05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107538150 (IL33)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107538150 (IL33)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    107538150 (IL33)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    107538150 (IL33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107538150 (IL33)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Interleukins
   107538150 (IL33)
SSDB
Motif
Pfam: IL33 IL1 AbfB
Other DBs
NCBI-GeneID: 107538150
NCBI-ProteinID: XP_016069795
LinkDB
Position
Unknown
AA seq 259 aa
MKCSTTKVSPANVNNSARKALVKSSRLRKSQKKAKEICQMYFMQLRSGLTIEKACYFREK
TTKRSSPKTAGDYKKLVFTAYQNGLEDLGPSAAFTFTGTINGSSILERSVSLSTYNDQSI
TFVFADGGYEIYVEELRKKQETDKVLFRYYDSQSPASETGDSVDGQKLMVSLSPTKDKDF
LLHANNKEDSVELQKCENPLPDQTFFFLHTEPGPSTCVSFECKSNPGVFIGVKDNHLALI
KLKDQTEHSRRENIKFKLS
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaagtgttcaaccaccaaagtttccccagcaaatgtaaacaactcagcaagaaaagcc
ctggtaaaatcttccaggttgagaaaatcccaaaagaaggccaaagaaatttgccagatg
tactttatgcagctacgctcaggccttaccatagaaaaggcctgttactttagggaaaaa
accaccaaaaggagttcaccaaaaacagctggagattacaaaaagctggtcttcactgcc
tatcagaatggcctggaagaccttggaccatctgcagccttcacctttactggaacaatc
aatggttcaagtatcctagaacgttctgtttccttgagcacatacaacgatcaatccatt
acttttgtttttgcggatggaggttatgagatctatgttgaagaattgaggaaaaaacaa
gagacagacaaggtgttattccgttactatgattcacaatcacctgcaagtgaaacaggt
gatagtgttgatggtcagaaattaatggtaagcctgagtcctacaaaagacaaagacttc
ttgctgcatgccaacaacaaggaggactctgtggagctacaaaaatgtgaaaacccgttg
ccagaccagactttcttttttcttcatacagagcctgggccctccacatgtgtttcattt
gaatgcaagagcaatcctggagtgtttattggagtaaaggataaccatcttgctctaatt
aaattaaaggaccaaactgagcattcaagaagagagaatatcaaatttaagctctcttaa

DBGET integrated database retrieval system