KEGG   Miniopterus natalensis (Natal long-fingered bat): 107540803
Entry
107540803         CDS       T05883                                 
Name
(RefSeq) integrin alpha-X-like
  KO
K06462  integrin alpha X
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04610  Complement and coagulation cascades
mna04810  Regulation of actin cytoskeleton
mna05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107540803
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    107540803
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107540803
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mna04515]
    107540803
   04090 CD molecules [BR:mna04090]
    107540803
Cell adhesion molecules [BR:mna04515]
 Integrins
  Integrin alpha subunits
   107540803
CD molecules [BR:mna04090]
 Proteins
  107540803
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 107540803
NCBI-ProteinID: XP_016073128
LinkDB
Position
Unknown
AA seq 1194 aa
MIRTRASLLLLMALASSHGFNLDSDKPTIFSRNSAGFGHSVVQYANSWVVVGDPQEIKAA
NQTGSLYQCDYSTGTCEPVQLQVPPEAVNMSLGLSLTAATNPSQLLACGPTVRHACKENM
YLTGFCFLLASPSWQAQRLPAALQECPRLEQDIVFLIDGSGSISDADFVKMLTFVKAVMS
QFQRPSAQFSLMQFSSKFKIHFTFRDFARSSDPPRLLNSVHKLGGSTRTATAILMVINQL
FSAQNGARKGASKILIVITDGQKMGDRLDYKDVIPWAEAAGILRYAVGVGEAFQNQHSWI
ELNNIASTPSHEYIFRVENFDALRDIQKQLKEKIFAIEGTQTVSNSFFEFEMSQEGFSAV
LTPDGPVLGAVGSFSWSGGAFMYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQS
LVLGAPRHQHTGKVVIFTQASGQWKPKAEVTGTQVGSYFGASLCSVDVDRDGSSDLVLIG
APHYYEPTQGGQVSVCPLPRGRARWQCEVILRGEQGHPWGRFGAALTILGDVNGDKLTDV
AIGAPGEQENQGAVYLFHGTSGLGISPSHSQRVAGSQFSPRLQHFGQSLSGGQDLTMDGL
VDLAVGAQGHALLLRTRPVLRVRVNIRTTFTEIARSLFQCQEHTASVQELGDANVCLHVH
ESPKNRLSNLQSTVTFDLTLDPGRLNPRAIFKETNTRHLTRVRDLGLRQHCEAVKLLLPA
CVEDSATPINLRLNFSLVGSPIPSFGNLQPMLAPDAPRYFMASLPFEKNCGADHVCQDDL
GISFGFSGLKTLLVGSNLELSMEVKVWNDGEDSYGTTVTFSYPPGLSYRRVTVTQSHLLS
RSLHLACDSATDGSQDTWSTSCSIKYVIFGEGARINFRATFDVSPSARLGDRLLLTANVS
SENNTPRTSKTTFQLELPVKYAVYTVISSHEESTKYLNFSASEEEGSSVAQHRYQVNNLG
QRDLPVSIHFSVPVELNQVTVWSELEIFHPQNTSLQCSSERIAPSESNFQAHIQKNPVLD
CSIAHCLRFRCDIPSFGIQEELDFILKGNLSFGWVSQTLQKKVSVVSVAEITFDTSVYSQ
LPGQEAFLRAQMKMVLEKHEAHNPVPLIVGSSVGGLLLLALITAALYKAGFFKRQYKEMM
ADANGPSAPENGTSDPQSILKDVSDGKLIRLWRRGGKEMGSPQWLFFHLGRSLE
NT seq 3585 nt   +upstreamnt  +downstreamnt
atgatcaggaccagggcatcccttctcctgttgatggccttggcttcttctcacggcttc
aacttggactcggacaagccgacaatcttctccaggaacagtgctgggtttggacacagt
gtggtccagtacgccaactcctgggtggtggttggggacccccaggagataaaggctgcc
aaccaaacgggcagcctctaccagtgtgactatagcacgggcacctgtgagcccgtccag
ctgcaggtccccccagaggctgtgaacatgtccttgggcctatctctgacagctgccacc
aacccctctcagctgctggcctgtggccccactgtgcgccatgcatgcaaggagaacatg
tacttgactgggttctgcttcctgctggcttccccttcctggcaggcccagaggctccca
gctgctctgcaggagtgcccaaggctggagcaggacattgtcttcctgattgatggctca
ggcagcatctccgacgccgattttgtcaagatgctgaccttcgtgaaggctgtgatgagc
cagttccagagacccagcgcccagttctccctgatgcagttctccagcaagttcaagatt
cacttcacgttcagagacttcgcgcgcagctcagacccgccgcgcctgctgaactctgtg
cacaagctgggagggtccacgcgcacggccacagccatcctgatggtcataaaccagctg
ttcagtgcccaaaatggggcccgaaagggtgcctccaagatcctcattgtcatcaccgac
gggcagaaaatgggcgaccgcctggactacaaggatgtcatcccctgggctgaggcagcg
ggcatcctccgctacgcggtcggggtgggagaggcttttcaaaaccaacactcctggata
gaattgaacaacatcgcatcgacgccctcccatgaatatatatttagagtggagaacttt
gatgctttgagagacattcagaagcaactgaaagagaagatctttgctattgagggtacg
cagaccgtaagcaacagtttcttcgaatttgagatgtcccaggagggcttcagcgctgtg
ctcacacctgatgggccagttctgggtgctgtggggagcttcagctggtctggaggtgcc
ttcatgtaccccccgaatatgagccccaccttcatcaacatgtctcaggagaatgtggac
atgagggactcttacctgggctactccaccgagctggccctttggaagggggtgcagagc
ctggtcctgggggccccccgccatcagcacaccgggaaggttgtcatcttcacccaggct
tctgggcagtggaagccaaaggctgaagtcacagggacccaggttggctcctacttcggg
gcctctctctgctccgtggatgtggacagagatggcagctctgacctggtcctcatcggg
gctccccattactacgaaccgacccaggggggccaggtgtctgtgtgccccttgccccgg
gggagggctaggtggcagtgtgaggtcattctccgtggggagcagggccacccctggggc
cgctttggggcagccctgaccattctgggggacgtgaatggggacaagctgacagatgtg
gccatcggggccccgggagaacaggagaaccagggtgctgtctacctatttcacggaacc
tcagggctgggcatcagcccctcccacagccagcgggtcgcaggatcccagttctccccc
aggctccagcatttcgggcagtcgctgagcgggggtcaggatctcaccatggacggactt
gtggacctggccgtaggggcccaggggcacgcgctgctgctcaggaccagacctgtgctc
agggtgcgggtgaacatccgcacaacatttacagagattgctaggtctctgttccagtgc
caggagcacacggcctccgtccaggagctgggtgatgccaatgtctgccttcatgttcat
gagagtcccaagaaccggctgagtaacctccaaagcactgtgacctttgacttgaccctt
gaccctggccgcctgaatcccagagccatcttcaaggagacgaacactcggcatctgact
cgggtcagagatcttgggctgagacagcactgcgaggctgtgaagctgctgctcccggct
tgtgtggaggactcagcgacccccatcaatttgcgtctcaatttctccctggtgggcagc
cccatcccttcctttggaaacctgcagcctatgctggctcccgacgcccccagatacttc
atggcctctctcccctttgagaagaactgtggagctgaccatgtctgccaggatgacctt
ggcatctcctttggcttctcaggcttgaagaccctgctggtgggtagtaacctggagctg
agcatggaagtgaaagtgtggaatgatggtgaggactcctatgggaccacagtcaccttc
tcctacccaccagggttgtcttatcgacgtgtgacagtgacccagagccatctgctgtca
cgctccctgcacctggcctgtgacagtgccacagacggcagccaggacacctggagcacc
agctgcagcatcaaatacgtgatcttcggggagggcgctcggatcaacttcagggccacc
tttgacgtctcccccagcgcgaggctgggagaccggctgctcctgacggccaacgtgagc
agtgagaataacacccccagaaccagcaagaccaccttccagctggagctccccgtgaag
tacgctgtctacaccgtgatcagcagccatgaagaatccaccaagtacctcaacttctcg
gcctcagaggaagagggaagcagcgtggcccagcatagataccaggtgaacaacttggga
cagagggacctgccagtcagcatccacttctcagtgcctgtggagctgaaccaggtgact
gtgtggtcagagttggagatcttccacccccagaacacatctcttcagtgctcttcagag
agaattgcgccctcagagtccaacttccaggcccacattcagaagaatcctgtgctggac
tgctccattgctcactgtctgaggttccgctgtgacatcccctccttcggcatccaggag
gaacttgacttcatcctgaagggcaacctcagctttggctgggtcagccagacgctgcag
aagaaggtatcggtcgtgagtgtggctgaaatcacgttcgacacatctgtgtattcccag
cttccaggccaggaggcgtttttgagagcccagatgaagatggtgctggagaaacatgag
gcccacaaccctgtccccctcattgtgggcagctctgtgggaggactgctgctgctggct
ctcatcacagccgcactgtacaaggctggcttcttcaaacgtcagtacaaagaaatgatg
gcggatgcaaatggaccaagtgccccagaaaatggaacatcagacccccaatccatcctc
aaggatgtctctgatgggaaactgataaggctgtggaggaggggtggcaaggagatgggc
agccctcagtggctattcttccacctgggaaggtcattggagtga

DBGET integrated database retrieval system