KEGG   Miniopterus natalensis: 107540994
Entry
107540994         CDS       T05883                                 

Symbol
MTOR
Name
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04066  HIF-1 signaling pathway
mna04072  Phospholipase D signaling pathway
mna04136  Autophagy - other
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04218  Cellular senescence
mna04371  Apelin signaling pathway
mna04613  Neutrophil extracellular trap formation
mna04630  JAK-STAT signaling pathway
mna04659  Th17 cell differentiation
mna04714  Thermogenesis
mna04910  Insulin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04920  Adipocytokine signaling pathway
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05221  Acute myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107540994 (MTOR)
   04371 Apelin signaling pathway
    107540994 (MTOR)
   04630 JAK-STAT signaling pathway
    107540994 (MTOR)
   04066 HIF-1 signaling pathway
    107540994 (MTOR)
   04072 Phospholipase D signaling pathway
    107540994 (MTOR)
   04151 PI3K-Akt signaling pathway
    107540994 (MTOR)
   04152 AMPK signaling pathway
    107540994 (MTOR)
   04150 mTOR signaling pathway
    107540994 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107540994 (MTOR)
   04136 Autophagy - other
    107540994 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    107540994 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107540994 (MTOR)
   04659 Th17 cell differentiation
    107540994 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107540994 (MTOR)
   04920 Adipocytokine signaling pathway
    107540994 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    107540994 (MTOR)
   04919 Thyroid hormone signaling pathway
    107540994 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    107540994 (MTOR)
   04213 Longevity regulating pathway - multiple species
    107540994 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    107540994 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107540994 (MTOR)
   05206 MicroRNAs in cancer
    107540994 (MTOR)
   05205 Proteoglycans in cancer
    107540994 (MTOR)
   05207 Chemical carcinogenesis - receptor activation
    107540994 (MTOR)
   05230 Central carbon metabolism in cancer
    107540994 (MTOR)
   05231 Choline metabolism in cancer
    107540994 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107540994 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107540994 (MTOR)
   05212 Pancreatic cancer
    107540994 (MTOR)
   05225 Hepatocellular carcinoma
    107540994 (MTOR)
   05226 Gastric cancer
    107540994 (MTOR)
   05214 Glioma
    107540994 (MTOR)
   05221 Acute myeloid leukemia
    107540994 (MTOR)
   05215 Prostate cancer
    107540994 (MTOR)
   05224 Breast cancer
    107540994 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107540994 (MTOR)
   05168 Herpes simplex virus 1 infection
    107540994 (MTOR)
   05163 Human cytomegalovirus infection
    107540994 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107540994 (MTOR)
   05165 Human papillomavirus infection
    107540994 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107540994 (MTOR)
   05014 Amyotrophic lateral sclerosis
    107540994 (MTOR)
   05016 Huntington disease
    107540994 (MTOR)
   05017 Spinocerebellar ataxia
    107540994 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    107540994 (MTOR)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    107540994 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107540994 (MTOR)
   04931 Insulin resistance
    107540994 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107540994 (MTOR)
   01522 Endocrine resistance
    107540994 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107540994 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107540994 (MTOR)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107540994 (MTOR)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   107540994 (MTOR)
Membrane trafficking [BR:mna04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    107540994 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME TPR_19 EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 107540994
NCBI-ProteinID: XP_016073379
LinkDB
Position
Unknown
AA seq 2549 aa
MLGTGPAAATTATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFSTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKIYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQCPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNTTTAASTTAATTTATSTEGSNSESEAESSENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLD
VPIQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttggaaccggacctgccgccgccaccacagctaccacgacatctagcaacgtgagc
gttctgcagcagtttgccagtggcctgaagagccgcaatgaggagaccagggccaaagct
gccaaggagctccagcactatgttaccatggagcttcgagagatgagtcaagaggagtct
actcgcttctatgatcagctgaaccatcacatttttgaactggtttccagctcagatgcc
aacgagaggaaaggtggtatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaattgggcgattcgctaattatcttcggaacctcctcccctctaatgaccca
gttgtcatggaaatggcatccaaggccattggtcgccttgccatggcaggggacactttt
accgctgagtatgtggagtttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacacgcagctgttctggttctccgtgagttggccatcagcgtcccc
accttcttcttccaacaagtgcaacccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgcgagggagctgtggccgcccttcgtgcctgtctgattctcacc
acccagcgtgagccgaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagagaaagggtttgatgagaccttggccaaggagaagggcatgaatcgggacgatcgg
atccatggagctttgctgatcctcaacgagctggtccgaatcagcagcatggagggagag
cgcctaagagaagaaatggaggaaatcacacagcagcagttggtacatgacaagtactgc
aaagacctcatgggcttcagcacgaagcctcgtcacattacccccttcaccagtttccag
gctgtacagccccagcagtcaaacgccttggtgggactgctggggtacagctctcatcaa
ggcctcatggggtttggggcttcccccagcccagctaagtccaccctggtggagagtcgg
tgttgcagagatctaatggaggagaaatttgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgattcaaatgacaatccttaatttgctaccccgcttggcc
gcattccgaccttctgctttcacagatacccagtacctccaggataccatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggcttctt
tctgtggctgtgaggtctgagttcaagatctatttacctcgtgtgctggacatcattcga
gcagccctgccccctaaggactttgcccacaagagacagaaggccatgcaggtggatgcc
acagtattcacctgcatcagcatgctggctcgggcaatggggccaggcatccagcaggac
atcaaggagctgctggagcctatgctggcggtgggactgagccccgccctcacagctgtg
ctctacgacctgagccgtcagattccgcagctgaagaaggatatccaagatgggctactg
aagatgctatccctggtcctcatgcacaagcccctccggcacccaggcatgcccaagggc
ctggcccatcagctggcttcccctggcctcacaaccctccctgaggccagtgatgtgggc
agcatcactcttgccctccgaactcttggcagctttgaatttgaaggacactctctgacc
cagtttgtccgccactgtgcggatcattttctgaacagtgagcacaaggagatccgcatg
gaagctgcccgcacctgctcccgcctgctcacgccctctgtccacctcatcagcggccat
gctcacgtggtcagccagactgcagtgcaggtggtggcagatgtgctcagcaagctgctt
gtggtcgggataacagaccctgaccctgacattcgctattgtgtcttggcatccctggat
gagcgctttgatgcacacctggcccaggcagagaatttgcaggccctgtttgtggccctg
aatgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccggctcagtagc
atgaacccagccttcgtcatgccttttctgcgcaagatgctcatccagattttgacagag
ctggagcacagcggtattggaagaatcaaagagcagagtgcccgcatgctgggtcacctg
gtttccaacgctccccgactcatccgcccctacatggagcctattctaaaggctttaatt
ttgaagctgaaagatccagaccctgatccaaaccctggtgtgatcaataatgtcttggct
acaataggagagttggctcaggttagtggcctagaaatgaggaaatgggtagatgaactt
tttattatcatcatggacatgctccaggactcctctctgttggccaaaaggcaggtggcc
ctgtggacactgggacagttggtggccagcactggctatgtggtggagccctacagaaag
taccccactttgcttgaggtgctgctgaatttcctgaagactgagcagaaccagggcaca
cggagagaggccattcgtgtgttagggcttttgggggccttggatccctacaagcacaag
gtgaacatcggcatgatcgaccagtcccgggatgcttctgctgtcagcctgtctgaatcc
aagtcaagccaggattcctctgactatagcaccagtgaaatgctggtcaacatgggaaat
ctgcctctggacgagttctacccagccgtgtccatggttgccctgatgcggatcttccga
gaccagtccctctcgcaccatcacaccatggtcgtccaggccatcaccttcatcttcaag
tccctggggctcaaatgtgtgcagttcctgccccaggtcatgcccacattcctgaatgtc
atccgggtctgtgatggggccatccgggaatttctgttccagcagctgggaatgctggtg
tccttcgtgaagagccacatcagaccttacatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcaatccagagcacaatcattcttctcattgagcaaattgtg
gtagctcttggcggtgaattcaagctctacctgcctcagctgatcccacacatgctacgg
gtcttcatgcatgacaacagcccaggccgcatcgtctccatcaagctgctggctgcaatc
cagctatttggcgccaacctagacgactatctgcacttgttgttgccccccatcgtgaaa
ctgttcgatgcccctgaagttccactgccctctcggaaggcagcactggagacagtggac
cgcctgaccgagtccctggacttcaccgactatgcctcccggatcattcacccgattgtc
cgaacactggaccagtgcccagaattgcgccccacagccatggacacgttgtcttcactc
gtcttccagctggggaagaagtaccaaattttcattccaatggtgaacaaagtcctggtg
cgacaccgaatcaaccaccagcgctacgatgtcctcatctgcaggattgtcaagggctac
accctggctgatgaagaggaggaccctttgatttaccagcaccgaatgttgaggagtggc
caaggggatgcactggctagtggaccagtagaaacgggacccatgaagaaactgcacgtc
agcaccattaacctccaaaaggcctggggagctgccagaagggtctccaaagatgactgg
ctggagtggctgaggcggctgagcctggaattgctgaaggactcctcatcaccctccctg
cgctcatgctgggccctggctcaggcctacaacccgatggccagggatctcttcaacgct
gcctttgtgtcctgctggtctgaactgaacgaagaccagcaggatgagctcatcagaagc
atcgagttggccctcacctcacaggacatcgccgaagtcacacaaactcttttaaacttg
gctgaatttatggaacacagtgacaagggccccctgccattgagagatgacaatggcatt
gttttgctgggtgagagggctgccaagtgccgagcatatgccaaagcgctacactacaaa
gaactggagttccagaaaggtcccacccccgccatcctagagtctctcatcagcattaat
aataagctacagcagccggaggcagctgctggggtgttggaatacgccatgaaacacttc
ggagagctggagatccaggccacctggtatgagaagctgcacgagtgggaggatgccctt
gtagcctatgataagaaaatggacaccaacaaggacgaccccgagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatgggggcagctccaccagcagtgctgtgaaaag
tggaccctggttaacgacgagacccaagccaagatggcccggatggctgctgcagctgcg
tgggggctaggtcagtgggacagcatggaggagtacacctgtatgatcccccgagacacc
cacgacggggcattttacagagccgtgttagcactacatcaggacctcttctccctggcc
cagcagtgcatcgacaaagccagggacctgctggatgctgagttaactgctatggcagga
gagagctacagtcgggcatatggggccatggtttcctgccatatgctgtccgagctagag
gaggttatccagtacaaacttgtccccgagcgacgcgagatcatccgccagatctggtgg
gagagactgcagggctgccagcggattgtggaggactggcagaagatcctgatggtgcgg
tcccttgtggtcagccctcatgaggacatgaggacctggctcaagtatgcaagcctgtgt
ggcaagagtggcaggctggctcttgctcataaaaccttagtgttgctcctgggagttgat
ccgtctcggcagcttgaccatcctctgccaacagttcaccctcaggtgacctacgcctac
atgaaaaacatgtggaagagtgctcgcaagatcgatgccttccagcacatgcagcacttt
gttcagaccatgcagcagcaagcccagcacgccatcgccaccgaggaccagcagcacaag
caagagctgcacaagctcatggcccggtgtttcctgaaactcggggagtggcagctgaac
ctccagggcatcaacgagagcacaatccccaaagtcctgcagtactacagcgccgccacg
gagcacgaccgcagctggtacaaggcttggcacgcgtgggcagtgatgaactttgaagct
gtgctccactacaaacatcagaaccaagcccgtgacgagaagaagaagctgcgtcatgcc
agtggggccaacatcaccaacacaaccactgccgccagcacaacagctgccaccaccact
gccaccagcactgagggcagcaacagtgagagtgaagctgagagcagcgagaacagcccc
acgccctcgcctctgcagaagaaggtcactgaggatctgtccaaaaccctcttgatgtac
actgtccctgccgtccagggcttcttccgttctatctccttgtcacgaggcaacaacctc
caggacacgctcagagtcctcaccttatggtttgattatggtcactggccagatgtcaat
gaagccttagtggaaggggtgaaggcgatccagattgatacctggttacaggttatacct
cagctcattgcaagaattgatacgcccaggcccttagtgggacgcctcattcaccagctc
ctcacagacattggtcggtaccacccccaggccctcatctaccccctgactgtggcttct
aagtctacaaccacagcccgtcacaacgcagccaacaagattctgaagaacatgtgcgag
cacagtaacaccctggtgcagcaggccatgatggtgagtgaggagctgatccgagtggcc
atcctctggcatgagatgtggcatgaaggcctggaagaagcttcacgtttgtacttcggg
gagaggaatgtgaaaggcatgtttgaggtgctggagcccctgcatgcgatgatggaacga
ggaccccagactctgaaggagacatcctttaaccaggcatatggtcgagatttaatggag
gcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaaggatctcacccaagcc
tgggacctctattatcatgtgttcagacgcatctcaaagcagctgcctcagctcacatcc
ttagagctgcaatatgtttcccccaaacttctgatgtgccgggaccttgaattggctgtg
ccaggaacgtatgaccccaaccagccgatcattcgcattcagtccatagcaccatctttg
caagtcatcacatccaaacagaggccccggaagttgacacttatgggcagcaacggacat
gagtttgttttcctcctgaaaggccatgaagacctgcggcaggacgaacgagtgatgcag
ctcttcggcctggttaacacccttctggccaatgacccaacatctctccggaagaatctc
agcatccagcgatatgcagtcattcctctatcaaccaactcgggcctcatcggctgggtc
ccccactgtgacacgctgcatgccctcatccgggactacagggagaaaaagaagatcctt
ctcaacatcgagcatcgcatcatgttgcggatggctccagactacgatcacctaactctg
atgcagaaggtagaggtgtttgagcatgccgtcaataacacagctggggacgacctggcc
aagctgctatggctgaaaagccccagctccgaggtgtggtttgatcgaagaaccaattat
acccgctctttagctgtcatgtccatggttgggtatattttgggcctgggagatagacac
ccatccaacctgatgctggaccggctgagtgggaagatcctgcacattgactttggggac
tgctttgaggtcgctatgaccagagagaaattcccagagaagattccatttagactgaca
agaatgttgaccaatgctatggaggttactggtctggatggcaactacagaatcacctgc
catacagtgatggaggtgcttcgggaacacaaggatagtgtcatggccgtgctggaagcc
tttgtctacgatcccttgctgaactggaggctgatggacacaaataccaaaggcaacaag
cgatccaggacaagaacagattcctactctgctggccagtcagtagaaattttggatggt
gtagaacttggggaaccagcccataagaaaacggggaccacagtgccagaatctattcat
tctttcattggagatggtctggtcaaaccagaggccctaaataagaaagctattcaaatt
attaacagagttcgagataaactcactggtcgggacttctctcacgatgaaactttggat
gtcccaatacaagtggagctgctcatcaaacaagcaacgtcccacgaaaacctctgccag
tgctacattggatggtgtcctttctggtaa

DBGET integrated database retrieval system