KEGG   Miniopterus natalensis: 107543131
Entry
107543131         CDS       T05883                                 

Gene name
CD55
Definition
(RefSeq) complement decay-accelerating factor
  KO
K04006  decay accelerating factor
Organism
mna  Miniopterus natalensis
Pathway
mna04610  Complement and coagulation cascades
mna04640  Hematopoietic cell lineage
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107543131 (CD55)
   04610 Complement and coagulation cascades
    107543131 (CD55)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107543131 (CD55)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107543131 (CD55)
   04090 CD molecules [BR:mna04090]
    107543131 (CD55)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
    107543131 (CD55)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107543131 (CD55)
  Exosomal proteins of other body fluids (saliva and urine)
   107543131 (CD55)
  Exosomal proteins of colorectal cancer cells
   107543131 (CD55)
CD molecules [BR:mna04090]
 Proteins
  107543131 (CD55)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
 Antigens
  107543131 (CD55)
SSDB
Motif
Pfam: Sushi Sortilin_C
Other DBs
NCBI-GeneID: 107543131
NCBI-ProteinID: XP_016076072
LinkDB
Position
Unknown
AA seq 381 aa
MSPAGRGAPAALRLLPGLTPWLLLLLGPHSARGDCGLPPDIPNALPALGGSATFPENSIV
TYKCNDGFVKNAGKKDSVICHNSKWSDLKEFCSRSCDVPTRLRFASLQKIYISQNYFPAG
SVVDYECRVGYIRNHSLSSKLTCLQNFTWSIPDEFCTRKSCPDPGKIINGQVIIKTDILF
GSSITFSCNPGYKLVGTAISYCLRKGTDIGWSAPLPECKGKSSPTSKVTPTPPKPTTVYV
PRTKAPTTPLKPTTVDVPRTKAPTTPLKPTTVDVPAAQSQAVPRTTVTSKGSGTLSEGAK
AITFGVGGATVIISMLILAKIILDCGKSGTNIYNIDSFAYDASNHWLPGLATEEKRRKLT
QVSRILLVSYKFLEAWTQYMQ
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgagtcccgccgggcggggcgcccccgcagcgctgcgcctcctccccgggctgacgccg
tggctgctgctgctgctgggtccacactcggcgcgaggtgactgcggccttcccccggat
attcctaatgctctaccagctttgggaggtagcgcaacttttcctgaaaacagcatagtc
acctacaaatgcaatgacggcttcgtaaaaaacgctggcaagaaagactccgtgatctgt
cataacagcaaatggtccgacctcaaggaattttgtagccgtagctgtgatgttccaacc
aggctgcgttttgcatctctgcaaaagatttatatctcacagaattatttcccagcggga
tccgttgtggactatgaatgtcgtgtgggctacattaggaaccattccctatcatcaaaa
ctaacttgccttcagaattttacatggtccataccagatgaattttgtacaagaaaatca
tgtcctgaccctggaaaaataataaatggtcaagtcattataaaaactgacatattattt
ggctcatccatcaccttctcatgtaacccagggtacaaattagttggtacagctattagt
tactgccttcgtaagggaacggatattggttggagtgctccgttgccagagtgcaaaggt
aaaagttctccaacttccaaggtcacaccaactcctccgaaacccaccacagtgtatgtt
ccaagaaccaaagccccaacaactcctctgaaacccaccacagtggatgttccaagaacc
aaagccccaacaactcctctgaaacccaccacagtggatgttccagcagcacagagtcaa
gctgttcccaggacaactgtcacctctaaaggaagtggaaccctttctgaaggggctaaa
gcaattacatttggagtcggtggtgctactgtaataattagtatgctaattctagccaaa
attatcctggactgtggaaaatcagggacaaacatttataacattgatagttttgcttat
gacgctagtaaccactggctacctggcttagccacagaagaaaaaagaagaaagcttaca
caagtatccaggatacttctagtttcttataagtttctggaagcatggacacaatatatg
cagtag

DBGET integrated database retrieval system