KEGG   Miniopterus natalensis (Natal long-fingered bat): 107543368
Entry
107543368         CDS       T05883                                 
Symbol
AMFR
Name
(RefSeq) E3 ubiquitin-protein ligase AMFR
  KO
K10636  E3 ubiquitin-protein ligase AMFR [EC:2.3.2.36]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107543368 (AMFR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107543368 (AMFR)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.36  RING-type E3 ubiquitin transferase (cysteine targeting)
     107543368 (AMFR)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107543368 (AMFR)
  Multi subunit Ring-finger type E3
   ERAD complex
    107543368 (AMFR)
   LMBR1L-GP78-UBAC2 complex
    107543368 (AMFR)
SSDB
Motif
Pfam: G2BR zf-RING_2 zf-C3HC4_2 CUE zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-RING_11 zf-rbx1 zf-RING_5 zf-ANAPC11 zf-RING_16 Prok-RING_4 zf-C3HC4_4
Other DBs
NCBI-GeneID: 107543368
NCBI-ProteinID: XP_016076348
LinkDB
Position
Unknown
AA seq 604 aa
MSLKQFLSCFPFQQEETIFLSLVCIQVLVNTACCVLMLMAKLIQCIVFGPLRVSERQHLK
DKFWNFIFYKFIFIFGVLNVQTVGEVVMWCLWFAGLVFLHLMVQLCKDRFEYLSFSPTTP
MSSHGRVLSLLMAMLLSCCGLAVICCVTGYIHGMHTLAFMAVESLLVTVRTAHVILRYVI
HLWDLNHEGTWEGKGTYVYYTDFVMELTLLSLDLMHHIHMLLFGNIWLSMASLVIFMQLR
YLFHEVQRRIRRHKNYLHVVGNMEARFAVATPEELAVNNDDCAICWDSMQAARKLPCGHL
FHNSCLRSWLEQDTSCPTCRMSLNITDNNRVREDHQGENLDENLVPVAAAEGRPRLNQHN
HFFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYPLVLQD
LQLTRSVEITTDNILEGRIQVPFPTQRSDGIRPALNNPMERPNSDLEEGETSAQAERVPL
ALSPRLEEALDFSEVEAEPSEGEDFEARGSRFSKSADERQRMLVQRKDDLLQQARKRFLN
RSSEDDSASESCLASEGTTSDPVTRRLRMRTAGASEGTTSDPVTLRRRMLAAAAERRLQK
QQTS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgtccttgaagcagttcctgagctgctttccttttcaacaggaggaaacaatctttctt
tctttggtttgtatacaggttctagtcaatactgcttgctgtgttttgatgttgatggct
aagctgatccaatgtattgtgttcggccctcttcgagtgagcgagagacagcacctcaaa
gacaagttttggaattttattttctacaagttcattttcattttcggtgtgctgaatgtc
cagacagtaggagaggtggtcatgtggtgcctctggtttgctggacttgtatttctgcat
ctgatggttcagctctgcaaggaccgatttgaatatctctctttttctcccaccactccg
atgagcagccatggccgagttctgtctctgttgatggctatgctgctttcctgctgtgga
ttagcggttatctgctgtgtcacaggctacatccatgggatgcacacattggctttcatg
gctgtggagtctcttcttgtcacagtgaggactgctcatgtgattttacgatatgtaatc
cacctttgggacctcaatcatgaagggacgtgggaagggaagggaacgtacgtctattac
acagattttgtcatggagctcactctcttgtccctggacctcatgcatcatattcacatg
ttgttatttggcaacatctggttatccatggccagcttggtcatcttcatgcagctgcgt
tacctgtttcatgaggtccagcgtcgaatccgccggcacaagaactatttgcatgtcgtt
ggcaacatggaagccaggtttgcagttgcaactccagaggagctagctgtcaataatgat
gactgtgccatttgctgggactccatgcaggctgcaaggaagctgccatgtggccatctc
ttccacaactcctgtcttcgttcctggctagaacaagacacctcctgcccaacatgcaga
atgtctctgaacatcactgacaataatcgtgtcagggaggatcatcaaggagagaacttg
gatgagaatttagttcctgtcgcagccgctgaaggcagacctcgcttaaaccaacacaac
cacttcttccacttcgatgggtcccggattgcaagttggctgccgagtttttcagttgaa
gtgatgcacaccaccaacattctaggcatcacgcaggcaagcaactcccagcttaatgca
atggctcatcagattcaggagatgtttccccaggtcccatacccgctcgtgctgcaggac
ctccagctgacacgctcagttgaaataaccacagacaacattttagaaggacggattcaa
gtaccttttcccacacagcggtcagatggcattagacctgcattgaacaatcccatggaa
aggccaaacagtgacctggaggagggagaaacttctgcccaggcggagcgtgtgccactg
gctctcagccctcggctggaggaggcactggacttcagtgaggtggaggcggagcccagt
gagggggaagactttgaggcccgggggagccgcttctccaagtctgccgatgagagacag
cgcatgttagtccagcggaaggacgacctcctgcagcaggcgcggaagcgtttcctgaac
cgaagttctgaagatgactcggcctcagagagctgcctggcctcagaaggcacaacctcc
gaccctgtgacccgacgtctaaggatgcggacggcgggggcctcagaaggcacaacctcc
gaccccgtgaccctacgtcgaaggatgctggcggctgccgcagaacggagacttcagaag
cagcagacctcctag

DBGET integrated database retrieval system