KEGG   Miniopterus natalensis: 107543972
Entry
107543972         CDS       T05883                                 

Gene name
LTBR
Definition
(RefSeq) LOW QUALITY PROTEIN: tumor necrosis factor receptor superfamily member 3
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04064  NF-kappa B signaling pathway
mna04066  HIF-1 signaling pathway
mna04672  Intestinal immune network for IgA production
mna05166  Human T-cell leukemia virus 1 infection
mna05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107543972 (LTBR)
   04066 HIF-1 signaling pathway
    107543972 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107543972 (LTBR)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107543972 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    107543972 (LTBR)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107543972 (LTBR)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107543972 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107543972 (LTBR)
Cytokine receptors [BR:mna04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   107543972 (LTBR)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 107543972
NCBI-ProteinID: XP_016077199
LinkDB
Position
Unknown
AA seq 490 aa
METSNTLRNLAKSKDNALVTKNSWIPRSCALLHQDFSQPSPKACSASQMNQGLCGLLAAA
QPPLGRPYHPENHTCRDQEKEYYEPKHQACCSRCPPGTHVSAECSPGRDTVCIPCPESSY
NEHWNHLFICQLCRPCDRILGFEETAPCTSKQKTQCHCQPGMFCVRWDHECIHCESLSDC
PPGTEAEFKDEGGEANSHCVPCKAGHFQNTSSPIARCQPHTRCEDLGLVEAAQGTAQSDT
SCRNPEIPEIPGTMLVLAVMLPLVSLLLLTTIFACTWKSHPSLCRKLGSLLKSRPEGEES
NIADGNWQPPNINPHFPDLVKPLLPIPGDSPPALAWPPVPPALEEEVLQQQSPLSQAREL
EAELPEQGPVPHGTNGIHVTGGSVTVTGNIYIYNGPVLGGARGPGDPPAPPEPPYPIPEE
GAPGPPGLSTPYQEDGKAWHLAETEHWGAMPSNXGPRTQFVTHASWVSGRSQEKGRTRAP
SPEAALPTQD
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggaaaccagtaatactttaaggaacctggcgaagagcaaagacaatgccctggtcaca
aagaattcatggattcctcgctcctgtgccctgctgcaccaggacttctcacaaccatca
cctaaagcttgttcagccagtcagatgaaccagggcctctgcggcctcctggcggccgcc
cagcccccactggggcgcccctaccacccggagaaccacacctgccgggaccaggagaag
gagtactacgaacccaagcaccaggcttgctgctcccgctgccccccaggcactcacgtc
tcagctgaatgcagcccaggtcgggacacagtttgtatcccgtgccctgaaagttcctac
aacgagcactggaaccatctgttcatctgccagctgtgccgaccctgtgaccggatcctg
ggcttcgaggagactgcaccttgcactagcaaacagaaaacccagtgccactgccagccg
ggaatgttctgcgtccgctgggaccatgagtgtatacactgcgagtcgctctctgactgc
ccaccgggcactgaagctgagttcaaagatgaaggtggggaggctaatagccactgtgtg
ccctgtaaggccgggcacttccagaacacctcctcccccatcgcccgctgccagccccat
accaggtgtgaggacctgggccttgtagaagcagcacaaggtaccgcccagtctgatacc
agctgcagaaatccagagatccctgagataccaggaactatgctggtgctggccgtcatg
ctgcccctggtctccttgctgctcctcaccaccatcttcgcctgcacctggaagagccac
ccctctctctgcagaaagctgggatccctgctcaagagccgtccagagggagaggaatcc
aatattgctgatgggaactggcagcctccaaacatcaacccacactttcctgacctggta
aagccacttctgcctatccctggagactcgcccccggccttagcctggcccccagtgccc
ccagctttggaggaagaggtgctacaacagcagagtcctctgagccaggccagggagctg
gaggcagagctcccagagcaaggccctgtgccccacggtaccaatggcattcatgtcacc
ggcgggtctgtgactgtcactggcaacatctacatctacaatgggccagtactgggggga
gcacggggccctggagacccccctgctcccccggagcctccataccccattcctgaagag
ggtgcccctggtcctcccgggctctctacgccctaccaggaagatggcaaagcttggcac
ctggccgagacagagcactggggtgccatgccctctaacnnaggaccaaggacccagttt
gtcacccatgcctcatgggtgtctggaagaagtcaggagaagggacgcacgagagcacct
tctcccgaggctgccctacccacacaggattga

DBGET integrated database retrieval system