KEGG   Miniopterus natalensis: 107545841
Entry
107545841         CDS       T05883                                 

Definition
(RefSeq) platelet receptor Gi24
  KO
K23268  V-type immunoglobulin domain-containing suppressor of T-cell activation
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107545841
SSDB
Motif
Pfam: V-set ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 107545841
NCBI-ProteinID: XP_016079587
LinkDB
Position
Unknown
AA seq 313 aa
MGFPAAPEAGCRRWGPVLLALFLAASRGLVTAFKIATPYSLYVCPEGQNVTLTCRIVGLG
SAAKGHDVSFYKTWYRSSRGEVQACSDRRPIRNLTFQDLHLHHSGHQAANTSQDLARHHG
LESISDHHGNFSITMLHLTPQDDGLYCCLVVEIRHHHSEQRVHGAMELQVQRGNEAPSKC
IAYPSSPRESESITAAALATGACIVGILCLPLILLLVYKQRQVASNRRAQELVRMDSNAQ
GIENPGFEVSLPAQGMPEAKSRPPLSYMAQRQPSESGRHLLSEPSTPLTPAGPGDVFFPS
LDPVPDSPNSEAI
NT seq 942 nt   +upstreamnt  +downstreamnt
atgggcttccccgctgccccggaggctggctgccggcgctgggggcctgtgctcctcgct
ctcttcctggctgcctcccgaggtctggtgacagccttcaagatcgccacaccatattcc
ttgtacgtgtgtcctgaggggcagaacgtcaccctcacctgcagaattgtgggcttgggc
tccgcggccaaaggacacgacgtgtccttctacaagacatggtaccgcagttcacgggga
gaggtgcaggcctgctccgatcgccggcctatccgcaacctcacgttccaggatctgcac
ctgcaccacagtggccaccaggccgccaacaccagccaggatctggcccggcaccatggg
ctagagtcaatctctgaccaccacggcaacttctccatcaccatgctccacctgacccca
caggacgacggcctctactgctgcctcgtggtggagatcaggcaccaccactcagagcag
agggtccacggtgccatggagctgcaggtgcagagaggcaacgaagcaccgtccaagtgc
attgcatacccatcctcccccagggagagtgaaagcatcacagctgctgccctggctacg
ggtgcctgcattgtgggcatcctctgccttcccctcatcctgctcctggtctacaagcaa
agacaagtggcctccaaccgccgtgcccaggagctggtgcggatggacagcaacgctcaa
ggaattgaaaacccaggctttgaggtctctctacctgcccaggggatgccggaggcgaag
tccaggcccccattgtcctacatggcccagcggcagccttctgagtctgggcgccacctg
ctttctgagcccagcactcctctgactccagcaggccctggggatgtcttcttcccatcc
ctggaccctgttcctgactccccaaactctgaggccatctag

DBGET integrated database retrieval system