KEGG   Miniopterus natalensis (Natal long-fingered bat): 107546204
Entry
107546204         CDS       T05883                                 
Symbol
DDIT3
Name
(RefSeq) DNA damage-inducible transcript 3 protein
  KO
K04452  DNA damage-inducible transcript 3
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04010  MAPK signaling pathway
mna04141  Protein processing in endoplasmic reticulum
mna04210  Apoptosis
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05202  Transcriptional misregulation in cancer
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107546204 (DDIT3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107546204 (DDIT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107546204 (DDIT3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107546204 (DDIT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107546204 (DDIT3)
   05012 Parkinson disease
    107546204 (DDIT3)
   05014 Amyotrophic lateral sclerosis
    107546204 (DDIT3)
   05020 Prion disease
    107546204 (DDIT3)
   05022 Pathways of neurodegeneration - multiple diseases
    107546204 (DDIT3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107546204 (DDIT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107546204 (DDIT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107546204 (DDIT3)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    107546204 (DDIT3)
SSDB
Motif
Pfam: bZIP_2 GAS bZIP_1 DivIC Fungal_TACC DUF5595 DASH_Hsk3 CLZ TMEM247
Other DBs
NCBI-GeneID: 107546204
NCBI-ProteinID: XP_016080014
LinkDB
Position
Unknown
AA seq 168 aa
MAAESLPFSFGTLSNWELEAWYEDLQEVLSSDENGGAYISAPGNEEEESKTFTTLDPASL
AWLTEEPGPAEVTSTSQSPRSPDSSQSSLAQGEEEENQGIPRKRKWSGQSLARAGKQRVK
DKEQENERKVAQLAEENERLKQEIERLTREVEVTRRALIDRMVSLHQA
NT seq 507 nt   +upstreamnt  +downstreamnt
atggcagctgagtctttgcctttctccttcgggacactgtccaactgggaactggaagcc
tggtatgaggacctgcaggaggtgttgtcctcagatgaaaatgggggtgcctatatctca
gcccctggaaatgaggaggaagaatcaaaaaccttcaccactcttgaccctgcctctctg
gcttggctgactgaggaaccagggccagcagaggtcacaagcacctcccagagccctcgc
tctccagattccagtcagagctccctggctcagggcgaagaagaggaaaaccaaggaata
cccaggaaacggaaatggagtggtcagtccttagcccgggctggaaagcaacgcgtgaag
gataaagaacaagagaatgaaaggaaagtggcacagctcgctgaagagaatgaacggctc
aagcaggaaatcgagcgtctgaccagagaagtggaggtcactcgccgagctctaattgac
cgaatggtcagtctgcaccaagcatga

DBGET integrated database retrieval system