KEGG   Miniopterus natalensis (Natal long-fingered bat): 107546217
Entry
107546217         CDS       T05883                                 
Symbol
OS9
Name
(RefSeq) protein OS-9 isoform X1
  KO
K10088  protein OS-9
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107546217 (OS9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107546217 (OS9)
Lectins [BR:mna04091]
 P-type lectins
  107546217 (OS9)
SSDB
Motif
Pfam: PRKCSH PRKCSH_1
Other DBs
NCBI-GeneID: 107546217
NCBI-ProteinID: XP_016080035
LinkDB
Position
Unknown
AA seq 665 aa
MAAEPLLSRLLGLLLLGLLLPASLTGGVGSLNLEELSEMRYGIEILPLPVMGGQSQASDV
VIVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGIPELLNPMKDAPCLLKTKDWWTY
EFCYGRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSK
CDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAA
PQAILCHPALQPEEYMAYIQRQADSKQYEEKMIEELQDPQMWSETKSGVVPTKRAGASPT
KDGSKESDFWKMIHEPEDQVQGKDEAQAEEQETNIEPADPAPGSPSDFQNNVQVKVIRSP
ADLIRLIEELKGGAKKGKPHAGQEQPEDDAAEVPQREPEMKEKGDAEHPNEVEEEEEEED
DDEDEDERQLLGEFEKELEGILLPSDRERLRSEVKAGMEQELENIIQETEKELNPDGLKK
ESERDRAMLALTSTLNKLIKRLEEKQSPELVKKHKRRKIVPRKPSPSLRPAEEDPEHRVR
VRVTKLRHRGPNQDLTVLEMKRENPQLKQIEGLVKELLEREGLTAEGKIEIKIVRPGAEG
TEEDARWLTDEDTKNLKEIFFNILVQGAEEAQKERQRQKELESNYRRVWGSGGGEGTGDL
DEFDF
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggcggcagaaccgctgctgtccaggctgttggggttgctgcttttgggactcttgtta
cccgcaagcctgactggcggtgtcgggagcctgaacctggaggagctgagtgagatgcgt
tatgggatcgagatcctgccgttgcctgtcatgggagggcagagccaagcttcggacgtg
gtgattgtttcctctaagtacaagcagcgctatgaatgtcgcctgccagctggagccatt
catttccagcgtgaaagggaggaggagacacctgcttaccaagggcctgggatccccgag
ttgctgaacccaatgaaagatgctccttgcctgctgaagaccaaggactggtggacatac
gaattctgttatggacgccacatccagcagtaccacatggaagattcagagatcaaaggt
gaagtcctctatctcggctactaccaatcggccttcgactgggatgatgaaacagccaag
gcctctaagcagcatcgcctgaaacgctaccacagccagacctatggcaacgggtccaag
tgtgacctcaacgggaggccccgggaggctgaagttcggttcctctgtgacgagggagct
ggtatttctggggactacattgatcgtgtggatgagcccttgtcctgctcctatgtgctg
accattcggactcctcggctctgcccccatcctctcctccggcccccacccagtgctgct
ccccaagccattctctgccaccctgccctgcagcctgaggagtacatggcctacattcag
aggcaagctgactccaagcagtatgaagagaaaatgatagaggagctgcaagaccctcaa
atgtggagtgagaccaaatctggggtggtacctacaaagagagcaggtgcaagcccaacc
aaggatggcagtaaggaatcagatttctggaagatgattcatgaaccagaggaccaagtc
caaggaaaggacgaagcacaggctgaggagcaggaaacaaacattgagccagcagatcca
gctccaggctctcccagtgattttcagaacaatgtgcaggtcaaagtcatccggagtcct
gcagacttgattcgattgatagaggagctgaaaggtggagccaaaaaggggaagccacat
gcaggccaagagcagcctgaagacgatgctgcagaagtccctcaaagggaaccagagatg
aaggaaaagggggacgcagaacatccgaatgaggtggaagaagaggaggaggaggaggat
gacgatgaagatgaggatgaacggcagttactgggggaatttgaaaaggaactggaaggg
atactgctcccgtcagaccgagagcggctccgttcggaggtgaaggctggcatggagcag
gagctggagaacattatccaggagacagagaaggagctgaacccagatgggctgaagaag
gagtcagagcgggatcgggctatgctggccctgacatccactctcaacaaactcatcaaa
aggctggaggaaaagcagagtccagagctagtgaagaagcacaagagaaggaagattgtc
cccagaaagccttccccctccctccgaccagcagaggaggatcctgagcacagagtccgg
gtccgggtcaccaagctccgtcacagaggccccaatcaggatctgacagtcctcgagatg
aaacgggaaaacccacagctgaaacaaatcgaggggctggtgaaagagctgctggagagg
gagggactcacagctgaagggaaaattgagatcaaaattgtccgaccaggggctgaaggg
actgaggaggatgcacgctggctgactgatgaggacacgaaaaaccttaaagagattttc
ttcaatatcttggtacagggagctgaagaggcacagaaggaacggcagcgacagaaagag
ctggagagcaattaccgcagggtgtggggctctggaggtggggagggcacaggggacctg
gatgagtttgacttctga

DBGET integrated database retrieval system