Merops nubicus (carmine bee-eater): 103768386 Help Entry 103768386         CDS       T08417                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04115   p53 signaling pathway mnb04137   Mitophagy - animal mnb04140   Autophagy - animal mnb04210   Apoptosis mnb04621   NOD-like receptor signaling pathway mnb05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:mnb00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103768386 (BCL2L1)    04137 Mitophagy - animal     103768386 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     103768386 (BCL2L1)    04115 p53 signaling pathway     103768386 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103768386 (BCL2L1)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     103768386 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mnb01009]     103768386 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mnb03036]     103768386 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mnb02000]     103768386 (BCL2L1) Protein phosphatases and associated proteins [BR:mnb01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      103768386 (BCL2L1) Chromosome and associated proteins [BR:mnb03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     103768386 (BCL2L1) Transporters [BR:mnb02000]  Other transporters   Pores ion channels [TC:1]    103768386 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  103768386 NCBI-ProteinID:  XP_008933775 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MSSRNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEMDGVLNGSPSWQPPAFS GLTSQRHITLGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRI VSWMTTYLTDHLDPWIQENGGW NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaggaaccgggagctagtgattgactttgtttcctacaagctgtctcagaag ggatacagctggagtcagctggaggaggaggatgagaacaggactgactttgcagccgag gaggccgagatggacggggtcctcaacgggagcccctcctggcaacctcccgctttcagc ggcctcacctcccagcgccacatcaccctgggcacggcgtaccagagctttgagcaggtg gtgaacgaactcttccgcgacggagtgaactggggtcgcatcgtggctttcttctccttc ggaggggccctgtgcgtggagagcgtggacaaggagatgcgggtattggtgggacgcatt gtgtcttggatgaccacgtacttgaccgaccacctagacccctggatccaggagaatggc ggatgg

DBGET integrated database retrieval system