Merops nubicus (carmine bee-eater): 103769035 Help Entry 103769035         CDS       T08417                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04144   Endocytosis mnb04510   Focal adhesion mnb05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mnb00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103769035 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103769035 (CAV3)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     103769035 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnb04131]     103769035 (CAV3) Membrane trafficking [BR:mnb04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     103769035 (CAV3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin CCDC117 Motif Other DBs NCBI-GeneID:  103769035 NCBI-ProteinID:  XP_008934455 UniProt:  A0A091QG11 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MAEEHTELEERIIIKDQHTKEIDLVNRDPKHINEDVVKVEFEDVIAEPVGTYSFDGVWKT SYTTFTVSKYWCYRLLSALLGVPLAVIQCVSRIYSLCIHTFCDPLFEALSKICGNIRVAL RKEI NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggcagaggagcacaccgagctggaggagaggatcatcatcaaggaccagcacaccaag gagatcgacctggtgaacagagacccaaagcacataaacgaggacgtggtgaaggtggaa tttgaggacgtgatagcggagcctgtggggacgtacagcttcgacggcgtctggaaaacc agctacaccaccttcaccgtcagcaagtactggtgctaccgcctgctctccgccctcctg ggcgttcccctggccgtcatccagtgcgtcagccgcatctactccctctgcatccacacc ttctgcgaccccctcttcgaggcgctctccaagatctgcggcaacatcagagttgctctg cggaaggagatctag

DBGET integrated database retrieval system