Merops nubicus (carmine bee-eater): 103770806 Help Entry 103770806         CDS       T08417                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04621   NOD-like receptor signaling pathway mnb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mnb00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103770806  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103770806  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mnb03110]     103770806 Chaperones and folding catalysts [BR:mnb03110]  Protein folding catalysts   Protein disulfide isomerase    103770806 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 AhpC-TSA Thioredoxin_7 Thioredoxin_9 Glutaredoxin Thioredoxin_2 Redoxin Motif Other DBs NCBI-GeneID:  103770806 NCBI-ProteinID:  XP_008936332 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search AVRHWLVLEVINTYMVVCVAQAEFEAELKSAADKLVIVDFSATWCGPCKMIKPFFHSLCD KYSEAVFIEIDVDDAQ NT seq 229 nt NT seq  +upstreamnt  +downstreamnt agctgtaagacactggctggtgctagaagtgattaatacttacatggtggtatgtgtagc tcaggccgaatttgaggcagaactgaaatctgctgctgacaagcttgtgatagttgattt ctctgccacatggtgtggaccatgcaaaatgatcaagccgttcttccatagtttgtgtga caagtatagtgaagcggtgttcatcgaaattgatgtggatgatgcccag

DBGET integrated database retrieval system