Merops nubicus (carmine bee-eater): 103772450 Help Entry 103772450         CDS       T08417                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mnb  Merops nubicus (carmine bee-eater) Brite KEGG Orthology (KO) [BR:mnb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mnb03036]     103772450   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnb04147]     103772450 Chromosome and associated proteins [BR:mnb03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103772450 Exosome [BR:mnb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103772450 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  103772450 NCBI-ProteinID:  XP_008938035 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search IRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMP KDIQLARRIRGERA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atccgcaagctgcccttccagcgactggtcagagaaatcgcccaagatttcaaaacggac ttgaggttccagagtgcagccatcggggcgctgcaggaggccagcgaagcttatctggtg ggtctgtttgaagatacaaacctgtgcgccatccatgccaagagagtcaccatcatgccc aaagatatccagttggcccgcaggatacggggggagcgggcttaa

DBGET integrated database retrieval system