Merops nubicus (carmine bee-eater): 103774725 Help Entry 103774725         CDS       T08417                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04060   Cytokine-cytokine receptor interaction mnb04218   Cellular senescence mnb04620   Toll-like receptor signaling pathway mnb04621   NOD-like receptor signaling pathway mnb04622   RIG-I-like receptor signaling pathway mnb05132   Salmonella infection mnb05164   Influenza A Brite KEGG Orthology (KO) [BR:mnb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103774725  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     103774725  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103774725    04621 NOD-like receptor signaling pathway     103774725    04622 RIG-I-like receptor signaling pathway     103774725  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     103774725   09171 Infectious disease: bacterial    05132 Salmonella infection     103774725  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnb04052]     103774725    00536 Glycosaminoglycan binding proteins [BR:mnb00536]     103774725 Cytokines and neuropeptides [BR:mnb04052]  Cytokines   Chemokines    103774725 Glycosaminoglycan binding proteins [BR:mnb00536]  Heparan sulfate / Heparin   Chemokines    103774725 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103774725 NCBI-ProteinID:  XP_008940396 UniProt:  A0A091QV58 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MTGKAVAALLTLLLLFAAGTRGKALPRSAIELRCQCIGTHSKFIHPKFIENVNLTPSGPH CKNVEVIATLRDGREVCLEPTAPWVKLIIKAILDK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgacaggcaaggctgtggctgctctcctgactcttctcctcctcttcgcagctgggaca agaggcaaggccctgccacgctcagccattgagctccggtgccagtgcataggcacccat tccaagttcatccatcccaagttcatagagaatgtgaacctcactcccagcggacctcac tgcaaaaatgttgaagtcatagctactctgagagacggcagagaagtgtgcctggagcct acggctccctgggtgaagctgatcatcaaggcaattctggacaagtga

DBGET integrated database retrieval system