Merops nubicus (carmine bee-eater): 103774726 Help Entry 103774726         CDS       T08417                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04060   Cytokine-cytokine receptor interaction mnb04218   Cellular senescence mnb04620   Toll-like receptor signaling pathway mnb04621   NOD-like receptor signaling pathway mnb04622   RIG-I-like receptor signaling pathway mnb05132   Salmonella infection mnb05164   Influenza A Brite KEGG Orthology (KO) [BR:mnb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103774726  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     103774726  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103774726    04621 NOD-like receptor signaling pathway     103774726    04622 RIG-I-like receptor signaling pathway     103774726  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     103774726   09171 Infectious disease: bacterial    05132 Salmonella infection     103774726  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnb04052]     103774726    00536 Glycosaminoglycan binding proteins [BR:mnb00536]     103774726 Cytokines and neuropeptides [BR:mnb04052]  Cytokines   Chemokines    103774726 Glycosaminoglycan binding proteins [BR:mnb00536]  Heparan sulfate / Heparin   Chemokines    103774726 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103774726 NCBI-ProteinID:  XP_008940397 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MDGKSAAAALVLYLVLTAGSEGKAPVKTEGKSFPCLCRSTHSKFIPLKAIQNVRLSQRGP HCKHEEIIAELKGGRQVCLEPTAPWVRLTVKAILARARDNTESPVTEKSRKNTPWSFSRI NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatggcaaatctgctgctgctgctttggttctctacctggtcttaacagcagggtct gaaggcaaggccccggtgaagacagagggaaaaagcttcccatgcctgtgcagaagcacc cattccaagttcatccctctcaaggctattcaaaatgtgagattaagccaaaggggacct cactgcaaacatgaggaaatcatagctgagctgaaaggtggcagacaagtgtgtttggag cccactgctccctgggtccggctcaccgtaaaggctatcttggccagggccagagataac actgagtcaccagtcacagaaaagtcaaggaaaaatacaccttggagtttttcaaggata tga

DBGET integrated database retrieval system