Merops nubicus (carmine bee-eater): 103776879 Help Entry 103776879         CDS       T08417                                  Symbol TMEM218 Name (RefSeq) transmembrane protein 218   KO K26674   transmembrane protein 218 Organism mnb  Merops nubicus (carmine bee-eater) Brite KEGG Orthology (KO) [BR:mnb00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mnb03037]     103776879 (TMEM218) Cilium and associated proteins [BR:mnb03037]  Primary cilia and associated proteins   MKS complex    103776879 (TMEM218) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  103776879 NCBI-ProteinID:  XP_008942653 LinkDB All DBs Position Unknown AA seq 43 aa AA seqDB search IVDTFFIGRLVLVAIMSLVVLGCLPLLLVYHLLEPVYATPLHG NT seq 131 nt NT seq  +upstreamnt  +downstreamnt atcgtggacaccttcttcatcggccgcctggtcctggtggccatcatgagcctggttgtc ctgggctgcctgcccctgctgctggtgtaccacctcctggagcccgtgtacgccacgccg ctgcacggcag

DBGET integrated database retrieval system