Merops nubicus (carmine bee-eater): 103776961 Help Entry 103776961         CDS       T08417                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04010   MAPK signaling pathway mnb04137   Mitophagy - animal mnb04140   Autophagy - animal mnb04218   Cellular senescence mnb04371   Apelin signaling pathway mnb04625   C-type lectin receptor signaling pathway mnb04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:mnb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103776961 (RRAS2)    04371 Apelin signaling pathway     103776961 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103776961 (RRAS2)    04137 Mitophagy - animal     103776961 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     103776961 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103776961 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103776961 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnb04147]     103776961 (RRAS2)    04031 GTP-binding proteins [BR:mnb04031]     103776961 (RRAS2) Exosome [BR:mnb04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103776961 (RRAS2)   Exosomal proteins of bladder cancer cells    103776961 (RRAS2) GTP-binding proteins [BR:mnb04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103776961 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  103776961 NCBI-ProteinID:  XP_008942738 LinkDB All DBs Position Unknown AA seq 206 aa AA seqDB search MFLSGGRVSKPSSYNESSWTCTAFSAVVPVGAVGMVHESYFVTDYDPTIEDSYTKQCVID ERAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRD EFPMILVGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRLNVDQAFHELVRVIRKF QEQECPPSPEPTRKEKDKKGCHCVIF NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atgtttttgtcaggaggccgagtgagcaaaccctcctcatacaatgaaagctcttggacg tgcacggcgttcagcgccgttgtgccagttggtgcagtgggaatggtccatgagtcctat tttgttacggattatgatccaacgatcgaggactcctacaccaagcagtgtgtgatagat gaacgagctgcacgcttggacattttggatacagcaggacaagaagaatttggagccatg cgtgagcagtacatgaggacaggggagggtttcctgcttgttttctcagtcactgataga ggaagttttgaagaaatctataagtttcagcgacaaattcttagagtgaaagatcgtgat gagtttcctatgattctagttggtaataaagcagatctggaccaccaaagacaggtgaca caagaggaaggtcagcagctagcacggcaacttaaagtaacatacatggaagcctcagca aaaatcagattgaatgtagaccaagcttttcatgaacttgtcagagttataaggaaattt caagaacaagagtgccctccttcaccagagccaacacggaaagaaaaagacaagaaaggc tgccattgtgtcattttctga

DBGET integrated database retrieval system