Merops nubicus (carmine bee-eater): 103777735 Help Entry 103777735         CDS       T08417                                  Name (RefSeq) centrin-2   KO K10840   centrin-2 Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mnb00001]  09120 Genetic Information Processing   09124 Replication and repair    03420 Nucleotide excision repair     103777735  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mnb03019]     103777735    03036 Chromosome and associated proteins [BR:mnb03036]     103777735    03400 DNA repair and recombination proteins [BR:mnb03400]     103777735 Messenger RNA biogenesis [BR:mnb03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      103777735 Chromosome and associated proteins [BR:mnb03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     103777735    Centrosome duplication proteins     Centriole replication proteins      103777735 DNA repair and recombination proteins [BR:mnb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      XPC-HR23B-CETN2 complex       103777735 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_9 AIF-1 EF-hand_5 EH DUF7645 Dockerin_1 SUB1_ProdP9 SurA_N_3 SRI SPEF2_C EF-hand_14 SurA_N_2 EF_EFCAB10_C CNNM Nmad4 DUF5580_M MJ1010-like_2nd Motif Other DBs NCBI-GeneID:  103777735 NCBI-ProteinID:  XP_008943543 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MRALGFEPKKEEIKKMISDIDKEGTGKISFSDFLVVMTQKMAEKDTKEEILKAFRLFDDD ETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgagagcgttgggctttgaacctaagaaagaagagatcaagaaaatgatctcagatatt gataaggaagggacagggaaaatcagcttcagtgacttcttggtagtgatgacacagaaa atggctgaaaaagataccaaagaggagattctcaaagctttcagactctttgatgatgat gagactggcaaaatctctttcaaaaacctcaaacgtgtcgccaaggaactgggggaaaat ctgacagatgaggagctgcaggagatgatcgacgaagcagatcgagatggggatggggag gtcaacgaggaggagttcctgaggatcatgaagaagaccagcttgtactga

DBGET integrated database retrieval system