Merops nubicus (carmine bee-eater): 103777886 Help Entry 103777886         CDS       T08417                                  Symbol GPHB5 Name (RefSeq) glycoprotein hormone beta-5   KO K25484   glycoprotein hormone beta-5 Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:mnb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     103777886 (GPHB5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnb04052]     103777886 (GPHB5) Cytokines and neuropeptides [BR:mnb04052]  Neuropeptides   GPCR binding    103777886 (GPHB5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cys_knot Motif Other DBs NCBI-GeneID:  103777886 NCBI-ProteinID:  XP_008943700 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search WGRCQTWEKPVLEPPYVESHHRVCTYNETKMVTVKLPKCAPDVDPFYTYPVAIRCDCDIC STATTECETL NT seq 213 nt NT seq  +upstreamnt  +downstreamnt tggggacgctgccagacctgggagaaaccagtgctggaaccaccttatgtcgagtctcac caccgtgtttgcacctacaacgagaccaagatggtgacagtgaagctgcccaagtgtgcc cctgatgtggatcccttctacacctacccagtggccatccgctgtgactgtgacatctgc tccactgccacgactgaatgtgagaccctctga

DBGET integrated database retrieval system