Merops nubicus (carmine bee-eater): 103778259 Help Entry 103778259         CDS       T08417                                  Symbol NME6 Name (RefSeq) nucleoside diphosphate kinase 6   KO K00940   nucleoside-diphosphate kinase [EC:2.7.4.6] Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb00230   Purine metabolism mnb00240   Pyrimidine metabolism mnb00983   Drug metabolism - other enzymes mnb01100   Metabolic pathways mnb01232   Nucleotide metabolism mnb01240   Biosynthesis of cofactors Module mnb_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP mnb_M00050   Guanine ribonucleotide biosynthesis, IMP => GDP,GTP mnb_M00052   Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP mnb_M00053   Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP Brite KEGG Orthology (KO) [BR:mnb00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     103778259 (NME6)    00240 Pyrimidine metabolism     103778259 (NME6)   09111 Xenobiotics biodegradation and metabolism    00983 Drug metabolism - other enzymes     103778259 (NME6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mnb04131]     103778259 (NME6) Enzymes [BR:mnb01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.6  nucleoside-diphosphate kinase      103778259 (NME6) Membrane trafficking [BR:mnb04131]  Exocytosis   Calcium ion-dependent exocytosis    Kinases and associated proteins     103778259 (NME6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NDK Motif Other DBs NCBI-GeneID:  103778259 NCBI-ProteinID:  XP_008944085 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search GPMWAYILAHENAVPLWRSLMGPTKVFRARNSVPDSIRGSYGLTDTRNTTHGSDSPASAS REIAFFFPEFNEELWYQQEEPRLRWGPVHYNAEERVHAVPGAGGTELTPAPPG NT seq 339 nt NT seq  +upstreamnt  +downstreamnt tggccccatgtgggcttatatcttggcccacgagaatgctgttcccctgtggagatccct gatgggacccaccaaagtgttccgagcccgaaacagcgtcccagactccatccgaggatc ttatggcctcactgacaccaggaataccactcatggctcagattcaccagcgtcagccag cagagagattgcctttttcttcccagagttcaacgaagagctgtggtaccagcaggagga gccacgcctgcgctgggggccggtgcattacaacgcggaggagcgtgtccacgccgtgcc cggggctggaggcacggagctgaccccagcccccccggg

DBGET integrated database retrieval system