Merops nubicus (carmine bee-eater): 103779225 Help Entry 103779225         CDS       T08417                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb03082   ATP-dependent chromatin remodeling mnb04217   Necroptosis Brite KEGG Orthology (KO) [BR:mnb00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103779225  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103779225  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mnb03036]     103779225   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnb04147]     103779225 Chromosome and associated proteins [BR:mnb03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103779225 Exosome [BR:mnb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103779225 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  103779225 NCBI-ProteinID:  XP_008945100 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MAAVLESLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPN IQAVLLPKKTESHKAKSK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcggccgtgctggagtccctgacggccgagatcctggagctggcgggcaacgcggcc cgtgacaacaagaagacgcgcatcatcccccgccacctgcagctggccatccgcaacgac gaggagctcaacaagctgctgggcaaggtgaccatcgcgcagggcggggtgctgcccaac atccaggccgtgctgctgcccaagaaaactgagagccataaggctaagagcaaataa

DBGET integrated database retrieval system