Merops nubicus (carmine bee-eater): 103779945 Help Entry 103779945         CDS       T08417                                  Name (RefSeq) CD99 antigen-like   KO K06520   CD99 antigen Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04514   Cell adhesion molecule (CAM) interaction Brite KEGG Orthology (KO) [BR:mnb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     103779945  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:mnb04090]     103779945 CD molecules [BR:mnb04090]  Proteins   103779945 SSDB OrthologParalogGFIT Motif Pfam:  CD99L2 Glycophorin_A Motif Other DBs NCBI-GeneID:  103779945 NCBI-ProteinID:  XP_008945840 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search DFNLEDALNPGGFDDSDLIDSNLPRGGEGAGGGGSQGAIAGIVSAVFATVIGAVSSFIAY QKKKLCFKQSADEENVNMDSHRGAQSEPPGKRRF NT seq 287 nt NT seq  +upstreamnt  +downstreamnt atgattttaacttggaagatgctcttaatcctggtggctttgatgattcagatctgattg atagcaatttaccaagaggaggtgaaggagctggaggaggtggttctcagggagcaatag ctggaattgtaagtgctgtgtttgctactgtaatcggagcagtatctagtttcattgctt accagaagaagaaactctgtttcaaacaaagcgcagatgaagagaatgtgaatatggata gccatcggggagcacaatctgagccacctggtaagagaaggttctag

DBGET integrated database retrieval system